(data stored in ACNUC1104 zone)

EMBL: CP002026.PE439

CP002026.PE439       Location/Qualifiers
FT   CDS_pept        455247..456176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0443"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mpt:Mpe_A0871 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87776"
FT                   /db_xref="GOA:D7A358"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A358"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87776.1"
FT                   /translation="MDQIAAMRAFVRVVEAGNFSRAADLLEMPKPTITKLIQQLESHLR
FT                   TKLLNRTTRRVGVTPDGAAYYERALALLSDLDELDGSMTKAQTTPSGRLRVDVGSSLAL
FT                   NVLIPALPDFHARYPDIQLDLGVSDRPADLVGENIDCAIRGGELLDPSLIARRIGQVEL
FT                   VMCATPGYIQRHGMPQHPRDLRDGHRVIAYFSPRTGRRFAFDMIRGEETYELDLPYAVA
FT                   VNDSTAYLAACLTGLGIAHAVEPMIQPYLAAGTLVPVLPEWRGEPIVLHVVYAPNRHLS
FT                   SRLRVFVDWVAELFASGNVYRRRPEALF"
     atggaccaga tcgccgccat gcgggccttc gtccgggtcg tcgaggcggg caatttcagc        60
     cgtgcggccg acctgctgga gatgcccaag ccgaccatta ccaagttgat ccagcaactg       120
     gaatcgcatc tgcgcaccaa attgctgaac cgcacgacgc ggcgcgtcgg cgtgacgccg       180
     gacggcgccg cctattacga gcgggcgctg gcgctgctgt cggacctcga cgagctcgac       240
     ggctcgatga ccaaggcgca gaccaccccg tccggccggc tgcgcgtcga tgtcggctcg       300
     tcgctggcgc tcaacgtgct gatacccgcc ttgccggact tccacgcccg ctatcccgac       360
     atccagctcg acctcggcgt ctccgaccgg ccggcggatc tcgtcggcga gaacatcgac       420
     tgcgccatac gcggcggcga gctcctggac cccagcctca tcgcccgccg catcggccag       480
     gtggagctcg tgatgtgcgc gacgccgggc tacatccagc gccacggcat gccgcagcac       540
     ccgcgcgacc tgcgcgacgg gcaccgcgtc atcgcctatt tcagcccgcg caccgggcgg       600
     cgcttcgcct tcgacatgat ccgcggcgag gagacctacg agctcgatct gccctatgcg       660
     gtggcggtga acgattccac cgcctatctc gccgcctgcc tcaccgggct cggcatcgcc       720
     catgcggtcg agccgatgat ccagccctat ctcgccgccg gcacgctagt gccggtcctg       780
     ccggagtggc gcggcgagcc gatcgtgctg cacgtcgtct atgcgcccaa ccggcatttg       840
     agcagccgcc tgcgcgtctt cgtcgactgg gtggccgagc tcttcgcctc cggcaacgtc       900
     tatcgccgcc ggccggaggc gttgttctag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page