(data stored in ACNUC1104 zone)

EMBL: CP002026.PE442

CP002026.PE442       Location/Qualifiers
FT   CDS_pept        complement(457542..458216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0446"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: rhi:NGR_b21550 probable amino acid ABC
FT                   transporter, permease protein; TIGRFAM: polar amino acid
FT                   ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87779"
FT                   /db_xref="GOA:D7A361"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A361"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87779.1"
FT                   /translation="MNYAFDYGWLFEYWPVLAKGLAVTVELTLVGGVLGVALGVACAWA
FT                   RALGPSWLRPFVAAYVELIRNTPFLIQLFFIFFGLPALGLRMGELEAANLAMVVNLGAY
FT                   GCEIIRAGIQATPKGQFEAGASLGMSRIQTFWHVVLVPALQRIWPALSSQIVIVMLGSA
FT                   AVSQIATEDLTFAANFIQSRTFRAFEAYFVSTLIYLALAIALRQLLRGVGWTIFPRRGA
FT                   AR"
     atgaactacg cgttcgatta tggctggctg ttcgaatact ggccggtcct cgccaagggg        60
     ctcgccgtca ccgtcgagct gactttggtc ggcggcgtgc tgggcgtggc gctcggcgtc       120
     gcctgcgcct gggcgcgggc gctcgggccg tcatggctgc gcccgttcgt tgcggcctat       180
     gtcgagctga tccgcaacac ccctttcctg atccagctct tcttcatctt cttcggcctg       240
     ccggcgctcg gcctgcgcat gggcgaactg gaggccgcca acctcgccat ggtggtcaat       300
     ctcggcgcct atggctgcga gatcatccgc gccggcattc aggccacgcc gaagggccag       360
     ttcgaggccg gcgcctcgct cggcatgagc cgcatccaga ccttctggca tgtcgtgctg       420
     gtgccggcgc tgcagcgcat ctggccggcg ctgtcctcgc agatcgtcat cgtcatgctc       480
     ggctcggcgg cggtgtcgca gatcgccacc gaggacctga ccttcgcggc gaacttcatc       540
     cagtcgcgca ccttccgcgc cttcgaggcc tatttcgtct cgacgctgat ctacctcgcc       600
     ctcgccatcg cgctgcgcca actgctgcgc ggggtcggct ggacgatctt ccccaggcgt       660
     ggagcggcac gatga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page