(data stored in ACNUC1104 zone)

EMBL: CP002026.PE443

CP002026.PE443       Location/Qualifiers
FT   CDS_pept        complement(458406..459209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0447"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: avi:Avi_1513 ABC transporter substrate binding
FT                   protein (amino acid); PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87780"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D7A362"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87780.1"
FT                   /translation="MNPIFVHRRTLLALAAGALIASTQAPLPAHADALATIEANKVIRI
FT                   AVPQDFPPFGTVGADMQPKGYDVDMAKLIADKMGVKLELVPVTSANRIPYLQTNKVDLV
FT                   ISSLGKNPDREKVIDFSAAYAPFFNGVFGPAEVAAKDAKDLSGKTVGVTRGAVEDLELT
FT                   KIAPADVTIKRYEDNNGTISAFLSGQVDLIATGNVVAAAILERNPPKKPEIKFLIKNSP
FT                   CFIGLNKNEPALLAKVNDIIAAARKDGALEAISQKWLGAKLPAEL"
     atgaacccca ttttcgtcca ccgccgcacc ctccttgccc tcgccgccgg cgcgctgatc        60
     gcgagcacgc aggccccgct ccccgcccat gccgacgcgc tcgccaccat cgaggcgaac       120
     aaggtgatcc gcatcgccgt gccgcaggac ttcccgccct tcggcacggt cggcgccgac       180
     atgcagccca agggctacga cgtcgacatg gccaagctga tcgccgacaa gatgggcgtg       240
     aagctggagc tggtgccggt gacgagcgcc aaccgcatcc cctatctcca gaccaacaag       300
     gtcgacctcg tcatctcctc gcttggcaag aaccccgacc gcgagaaggt catcgacttt       360
     tccgccgcct atgcgccctt cttcaacggc gtgttcggcc cggccgaagt ggcggcgaag       420
     gacgccaagg acctctccgg caagacggtg ggtgtcaccc gcggcgcagt ggaagacctg       480
     gagctgacca agatcgcccc cgccgacgtc accatcaagc gctacgagga caataacggc       540
     accatctcgg ccttcctctc cggccaggtc gacctcatcg ccaccggcaa cgtggtcgcc       600
     gccgccatcc tcgagcgcaa cccgccgaag aagccggaga tcaagttcct gatcaagaac       660
     tcgccctgct tcatcgggct gaacaagaac gagccggcgc tgctcgccaa ggtcaacgac       720
     atcatcgccg ccgcccgaaa ggacggcgcg ttggaggcga tctcgcagaa atggctcggc       780
     gccaagctgc cggcggagct ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page