(data stored in ACNUC1104 zone)

EMBL: CP002026.PE444

CP002026.PE444       Location/Qualifiers
FT   CDS_pept        complement(459214..459957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0448"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: rhi:NGR_b21570 probable transcriptional
FT                   regulator protein, GntR family; PFAM: GntR domain protein;
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87781"
FT                   /db_xref="GOA:D7A363"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A363"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87781.1"
FT                   /translation="MNPATANIEEAILSAILAGRIAPGTRLGEQKLADLFGVSRTRVRE
FT                   AMMRLETRGVVQVSARRGWYVVEPSAEEAREAFQTRRVIETGLLQTVREVPPQVLASLK
FT                   EHVAMERQVIEAGDVSSRACLLGDFHIHLADALGNRLLTEIIRDLTARTTLISMLYQPT
FT                   EKAEESSHDHEDIVAAMEAGDLALAARLMDEHIGKVEAGLDLTARPDPLASLRELLTPS
FT                   AFAGNAPSVPHAHSHSHPPSLRKED"
     atgaaccccg ccaccgccaa tatcgaagag gcgatccttt ccgccatcct cgccggccgc        60
     atcgctccgg gcacgcggct gggcgagcag aagctggccg acctgttcgg cgtctcccgc       120
     acccgcgtgc gcgaggcgat gatgcggctg gagacgcgcg gcgtggtgca ggtcagcgcg       180
     cggcgcggct ggtacgtggt cgagccttcg gccgaggagg cgcgcgaggc gttccagacc       240
     cgccgcgtga tcgaaaccgg cctgttgcag accgtgcgcg aggtgccgcc gcaggtcctc       300
     gccagcctca aggagcatgt cgccatggag cggcaggtga tcgaggccgg cgacgtgtcc       360
     tcccgcgcct gcctgctcgg cgacttccac atccatctcg ccgacgcgct cggcaaccgg       420
     ctgctcaccg agatcatccg cgacctcacc gcgcgcacca cgctgatctc gatgctctac       480
     cagccgaccg agaaggccga ggaatccagc cacgaccacg aggacatcgt cgcggccatg       540
     gaggcgggcg acctcgccct cgccgcccgg ctgatggacg agcacatcgg caaggtcgag       600
     gccgggctcg acctcaccgc ccgtcccgat ccgctcgcaa gcctgcgcga actgctgacg       660
     ccgtcggcct tcgccggcaa cgccccctca gtgccgcacg ctcattccca ctcccatccc       720
     ccatcgctgc gaaaagagga ttga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page