(data stored in ACNUC1104 zone)

EMBL: CP002026.PE445

CP002026.PE445       Location/Qualifiers
FT   CDS_pept        complement(460216..462384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0449"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   KEGG: azc:AZC_1772 methylmalonyl-CoA mutase; PFAM:
FT                   methylmalonyl-CoA mutase; cobalamin B12-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87782"
FT                   /db_xref="GOA:D7A364"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D7A364"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ADH87782.1"
FT                   /translation="MTATARRIPDFSAIDWKAPALALPPEGAGAWETPERIAVKPLYGP
FT                   DDVAGLAFVDSYPGIAPFLRGPYPTMYATQPWTIRQYAGFSTAEDSNAFYRRNLAAGQK
FT                   GLSVAFDLATHRGYDSDHPRVAGDVGMAGVAIDSILDMRTLFSGIPLDRMSVSMTMNGA
FT                   VLPILALYVVAAEEQGVKPAQLSGTIQNDILKEFMVRNTYIYPPGPSMRIIADIFAFTA
FT                   KEMPRFNSISISGYHMQEAGATQDLELAYTLADGVDYVRAGIAAGMPVDAFAPRLSFFW
FT                   AIGMNFFMEVAKLRAARLIWAKLMKDLGASNPKSLPLRTHCQTSGWSLTAQDVFNNVMR
FT                   TMVEAMAATQGHTQSLHTNALDEALALPTDFSARIARNTQLLIQQESGTTRAIDPWGGS
FT                   FYVERLTADLAQKALGHIAEVEALGGMAKAIEAGIPKLRIEEAAAITQARIDSGAQTVV
FT                   GVNKYRPTREMLIDVLKVDNSAVRAAQLDKLRRLKAERDPQAVEAALAALENGARGNAN
FT                   LLALAIDAARAKATVGEISDALERVFGRHRAEIRAVTGVYRREAGAMGDRVARMRQRIE
FT                   AFEHEEGRRPRILVAKVGQDGHDRGQKVIASAFADLGFDVDIGPLFATPQEAARQAVEN
FT                   DVHVIGISSLAAGHLTLVPQVKAALAAEGRPDIMVVVGGVVPPQDYEAVRAAGAEAIYP
FT                   PGTVIAEAAEELVDKLAARLGHKKQAAE"
     atgaccgcca ccgctcgccg catccccgat ttcagcgcca tcgactggaa ggcgcccgcc        60
     ctcgccctgc cgcccgaggg cgccggcgcc tgggagactc ccgagcgcat cgcggtgaag       120
     ccgctctacg ggccggacga cgtcgccggg cttgccttcg tcgacagcta tcccggcatc       180
     gcgcccttcc tgcgcgggcc gtacccgacc atgtacgcga cgcagccctg gaccatccgg       240
     caatatgccg gcttctccac ggcggaggat tccaacgcct tctaccgccg caatctcgct       300
     gcgggtcaga aggggctgtc ggtcgccttc gacctcgcca cccatcgcgg ctacgattct       360
     gaccacccgc gcgtcgccgg cgacgtcggc atggccggcg tggcgatcga ttcgattctg       420
     gacatgcgca cgctgttctc ggggattccc ctcgaccgga tgagcgtgtc gatgaccatg       480
     aacggcgcgg tgctgccgat cctcgcgctc tatgtcgtcg ccgccgagga gcagggcgtg       540
     aagccggccc agctctcggg gaccatccag aacgacatcc tcaaggagtt catggtccgc       600
     aacacctata tctacccacc cggcccctcg atgcggatca tcgccgacat cttcgccttt       660
     accgccaagg agatgccgcg cttcaactcg atctcgatct ccggctacca catgcaggag       720
     gcgggggcga cgcaggacct cgaactcgcc tatacgctcg ccgatggcgt cgactatgtg       780
     cgcgccggca tcgcggcggg catgccggtc gacgccttcg cgccgcgcct ctccttcttc       840
     tgggcgatcg gcatgaactt cttcatggag gtcgccaagc tccgcgccgc ccggctgatc       900
     tgggccaagc tgatgaagga cctcggcgcc tcgaacccca agtcgctgcc gctgcgcacc       960
     cattgccaaa cctcgggctg gagcctgacc gcgcaggacg tgttcaacaa cgtcatgcgc      1020
     accatggtcg aggcgatggc ggcgacccaa ggccataccc agtcgctgca caccaacgcg      1080
     ctggacgagg cgctggcgct gccgaccgac ttttccgccc gcatcgcccg caacacgcaa      1140
     ttgctgatcc agcaggagag cggcaccacg cgcgccatcg acccgtgggg cggctccttc      1200
     tatgtcgagc ggctcactgc cgacctcgcg cagaaggcgc tcggccacat cgccgaggtc      1260
     gaggcgctgg gcggcatggc caaggccatc gaggccggca tccccaagct gcgcatcgag      1320
     gaggccgccg ccatcactca ggcgcggatc gattccggcg cccagaccgt ggtcggcgtg      1380
     aacaagtacc ggcccacgcg cgagatgctc atcgacgtgc tcaaggtcga caattcggcc      1440
     gtgcgcgccg cgcagctcga caagctcagg cgcctcaagg ccgagcgcga cccgcaggcc      1500
     gtcgaggcgg cgctggccgc gctggagaac ggcgcgcgcg gaaatgctaa cctgctggcg      1560
     cttgccatcg acgccgcccg cgccaaggcg acggtgggcg agatatcgga cgcgctggag      1620
     cgcgtcttcg gccggcaccg ggcggagatc cgtgcggtca ccggcgtcta ccggcgggag      1680
     gcgggagcga tgggcgacag ggtggcccgc atgcgccagc gcatcgaggc cttcgagcac      1740
     gaggagggcc ggcgcccgcg catcctcgtc gccaaggtcg ggcaggacgg ccatgaccgc      1800
     ggccagaagg tgatcgcctc ggccttcgcc gacctcggtt tcgacgtcga catcggcccg      1860
     ctcttcgcca cgccgcagga ggcggcgcgg caggcggtgg agaacgatgt ccacgtcatc      1920
     ggcatctcct cgctcgccgc cggtcacctg acgctagtgc cgcaggtgaa ggccgcgctc      1980
     gccgcagaag gccggccgga catcatggtg gtggtcggcg gcgtggtgcc gccgcaggac      2040
     tacgaggccg tgcgggcggc cggcgccgag gcgatctacc cgcccggcac ggtgatcgcc      2100
     gaggcggcgg aggaactcgt cgacaagctc gccgcgcgtc tcgggcacaa gaagcaggcg      2160
     gcggaataa                                                              2169
//

If you have problems or comments...

PBIL Back to PBIL home page