(data stored in ACNUC1104 zone)

EMBL: CP002026.PE446

CP002026.PE446       Location/Qualifiers
FT   CDS_pept        complement(462381..464237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0450"
FT                   /product="Methylmalonyl-CoA mutase"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: azc:AZC_1773 putative methylmalonyl-CoA
FT                   mutase; PFAM: methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87783"
FT                   /db_xref="GOA:D7A365"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D7A365"
FT                   /inference="protein motif:PRIAM:5.4.99.2"
FT                   /protein_id="ADH87783.1"
FT                   /translation="MDLDLASFPPATRADWLKLVEGVLKGAPYDKRMLTRTADGYTLDA
FT                   LPERRREAAAIVGRRAGASWKVIARIDHDDPAAANAQLLEDLDGGADGFSLVFASAPSA
FT                   GGFGLPVRHEELVQALKGVMPELITLRVEAGQYQGRDIALALARLFEAQDPARLDIRFG
FT                   LDPIGDFAALGAAPIEWDALSARLGQTVATLRARGLVSPMVRADGRLHHATGATDAQEL
FT                   AAVLATAIAYLRALEAAGLSLEDAAGAIEVTLTADVDQFGTQAKPRAFRQLWAAALSAC
FT                   GIEAKPVAIHMETAWRSLTRRDPHVNLLRGTIAAFAAGVGGADSVNVLPYTQALGLPDA
FT                   DARRLARNTQIILIEESHLHRVADPSAGAGAMEERTEKLAAAAWELFRQIEREGGMVES
FT                   LTSGAWQRRVAEARAARTKDVATRRLPITGTSEFPLLGEAVPTVLAPARRVAAAPPSEG
FT                   ALLCEPLTAQRLAEPFEHLRDAAEAAGARVFLADLGTAADFTPRAAFARSAFEAGGIAA
FT                   PANDGFADTAALAAAFRESGARLVCLCSSDEVYATSAAEAAKALRQAGAAAIYLAGRPG
FT                   EHEADWRAAGIDAYLYAGGDLLALLEEAHRRLGIPATREGSE"
     atggacctcg atctcgcctc cttcccgccc gccacccgcg ccgactggct gaagctggtc        60
     gagggcgtgt tgaagggcgc gccctacgac aagcgcatgc tcacccgcac ggccgacggc       120
     tacacactcg acgccctgcc cgagcgccgg cgcgaggccg cggccatcgt cgggcggcgg       180
     gcgggtgcgt cgtggaaggt gatcgcgcgg atcgaccatg acgacccggc ggcggccaat       240
     gcgcagctgc tggaagacct cgacggcggc gccgacggct tcagcctcgt cttcgcctcg       300
     gcgccctcgg ccggtggctt cggcctgccg gtccgccacg aggaactggt gcaggcgctc       360
     aagggggtga tgccggagct cattaccctg cgcgtcgagg cggggcagta tcagggccgc       420
     gacatcgccc tcgcgctggc gcggctgttc gaggcgcagg acccagcccg gctcgacata       480
     cgcttcgggc tggaccccat cggcgacttc gccgcgctgg gtgccgcgcc gatcgaatgg       540
     gacgcgctct ccgcccgcct cggccagacc gtggcgacgc tgcgcgcccg cgggctcgtc       600
     tcgcccatgg tgcgcgccga tggaaggctg caccacgcca ccggtgccac cgacgcgcag       660
     gaactcgccg cggtgctcgc caccgccatc gcctatctgc gcgcgctgga agcggcgggc       720
     ttgtcgctgg aggacgccgc cggcgccatc gaggtgacgc tcaccgccga tgtcgaccag       780
     ttcggcaccc aggccaagcc gcgcgccttc cgccagctct gggcggcggc gctgtccgcc       840
     tgcggcatcg aggccaagcc cgtcgccatc cacatggaga cggcgtggcg ctcgctgacc       900
     cgccgcgatc cgcatgtgaa cctgcttcgc ggcaccattg ccgcctttgc agcaggtgtc       960
     ggcggcgcgg atagcgtgaa cgtgctgccc tacacgcagg cgctcgggct tcccgacgcc      1020
     gatgcgcggc ggctcgcccg caacacgcag atcatcctga tcgaggaatc ccatctccac      1080
     cgcgtcgccg atccttcggc cggcgccggc gccatggagg aacgcacaga gaagctggcc      1140
     gccgccgcgt gggagctgtt ccgccagatc gagcgcgagg gcgggatggt ggagagcctc      1200
     acctccggcg cctggcagag gcgagtggcc gaagcccgcg ctgcgcgaac caaggacgtc      1260
     gccacccgcc ggctgccgat caccggcaca tcggaattcc cgctgctggg cgaagccgtg      1320
     ccgaccgtcc tcgcccccgc ccgccgcgtc gcggccgctc cgccttcgga gggcgcgctg      1380
     ctctgcgagc cgctcaccgc ccaacgcctt gccgagccat tcgagcacct ccgcgatgcc      1440
     gccgaggcgg cgggcgcgcg cgtgttcctc gccgacctcg gcacggccgc ggacttcacc      1500
     ccccgcgcgg ctttcgcccg cagtgctttc gaggccggcg gcatcgccgc gccggccaat      1560
     gatggctttg ccgacacggc ggcactggcc gcagccttcc gcgaatccgg cgcccgcctc      1620
     gtgtgcctgt gctcttccga cgaggtctat gcgacctcgg cggccgaggc ggcgaaggcg      1680
     ctccggcagg ccggcgccgc cgcgatctat ctcgccggcc ggccgggcga gcacgaggcc      1740
     gactggcgcg cggccgggat cgatgcctat ctctatgcgg gcggcgatct cctcgccttg      1800
     ctggaggagg cgcatcgccg gcttggcatc cctgcaacgc gggagggctc ggaatga         1857
//

If you have problems or comments...

PBIL Back to PBIL home page