(data stored in ACNUC1104 zone)

EMBL: CP002026.PE451

CP002026.PE451       Location/Qualifiers
FT   CDS_pept        complement(470100..471401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0455"
FT                   /product="glutamine synthetase, type III"
FT                   /note="KEGG: azc:AZC_1499 glutamine synthetase III;
FT                   TIGRFAM: glutamine synthetase, type III; PFAM: glutamine
FT                   synthetase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87788"
FT                   /db_xref="GOA:D7A370"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017536"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D7A370"
FT                   /inference="protein motif:TFAM:TIGR03105"
FT                   /protein_id="ADH87788.1"
FT                   /translation="MANDLAHAAKELGIKYFLISYVDLFGGLRAKLVPAAAIGGMQKAG
FT                   AGFAGFATWLDMTPADADLFAVPDPDSLIQLPWKPEVAWLASDLVMNDELVAQAPRNLL
FT                   KTTMLGADSIGYQMKTGVECEFFLTTPDGSKISDGADNATKPCYDQSALMRRYDVIKEI
FT                   CDSMLTLGWGPYQNDHEDANGQFEMNWNFGDALITADRHVFFKFMARSIAEKHGLRATF
FT                   MPKPFIDLTGSGCHMHTSLWSGDANVFEDEAGELGLSDIGYNFIGGLIHSADALCAITN
FT                   PTVNSYKRINAPRTVSGATWAPNTITYTGNNRTHMIRIPDAGRLELRLPDGAANPYLMP
FT                   AAVLAAGLDGVQNQRDPGKRLDINMYTDGHKVRGAKKLPLNLLDALRALEKSSVLRNAL
FT                   GAPFIDGYIKLKTEEWNAYSRHLTQWERDNTLDI"
     atggcgaacg acctcgcgca tgccgccaaa gagctcggca tcaagtattt cctgatctcc        60
     tatgtcgacc tgttcggcgg gctgcgggcc aagctggtcc cggccgctgc catcggcggc       120
     atgcagaagg cgggcgcggg cttcgccggc ttcgccacct ggctcgacat gacgccggcc       180
     gacgcggacc tgttcgccgt tcccgacccg gacagcctga tccagctgcc gtggaagccg       240
     gaggtcgcat ggctcgcctc ggacctcgtc atgaatgacg aactggtggc gcaggccccg       300
     cgcaacctgc tcaagaccac catgctgggc gccgattcca tcggctacca gatgaagacc       360
     ggcgtcgagt gcgagttctt cctgacgacg ccggatggct ccaagatctc cgacggcgcc       420
     gacaacgcca ccaagccctg ctacgaccag tccgccctga tgcgccgcta cgacgtcatc       480
     aaggagatct gcgacagcat gctcactctg ggctggggcc cgtaccagaa cgaccacgag       540
     gacgccaacg gccagttcga gatgaactgg aacttcggcg acgcgctcat caccgccgac       600
     cggcacgtct tcttcaagtt catggcccgc tcgatcgcgg agaagcacgg gctgcgcgcc       660
     accttcatgc ccaagccctt catcgacctc accggctcgg gctgccacat gcacacctcg       720
     ctgtggtcgg gcgacgccaa tgtgttcgag gacgaggccg gcgagctcgg cctgtcggac       780
     atcggctaca atttcatcgg cggactgatc cattcggccg acgcgctatg cgccatcacc       840
     aacccgacgg tgaactccta caagcgcatc aacgccccgc gcacggtctc cggcgccacc       900
     tgggcgccga acaccatcac ctataccggc aacaatcgca cccacatgat ccgcatcccc       960
     gatgcgggcc ggctggagct gcgcctgccg gacggggcgg cgaaccccta tctcatgccg      1020
     gccgccgtgc tcgccgccgg cctcgacggc gtgcagaacc aacgcgatcc cggcaagcgc      1080
     ctcgacatca acatgtacac ggacggccac aaggtgcgcg gcgccaagaa gctgccgctg      1140
     aacctgctcg acgccctgcg ggcgctggaa aagagctccg tgctgcgcaa cgcgctcggc      1200
     gcgcccttca tcgacggcta catcaagctg aagaccgagg aatggaacgc ttattcgcgc      1260
     cacctgaccc agtgggagcg cgacaacacg ctggatatct ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page