(data stored in ACNUC1104 zone)

EMBL: CP002026.PE452

CP002026.PE452       Location/Qualifiers
FT   CDS_pept        complement(471499..472836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0456"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   msl:Msil_2634 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87789"
FT                   /db_xref="GOA:D7A371"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A371"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ADH87789.1"
FT                   /translation="MSDHSNIPRTKPRASATFDDYTLSEIRRAAATGIYDIRGAGAKRK
FT                   VPHFDDLLFLGASMSRYPLEGYREKCSTEVVLGTRFAKKPIELKIPITIAGMSFGSLSA
FT                   NAKEALGRGASAMGTSTTTGDGGMTNEERGHSIQLVYQYLPSRYGMNPDDLKRADAIEV
FT                   VVGQGAKPGGGGMLLGQKITERVAAMRTLPVGIDQRSACRHPDWTGPDDLEIKIEELRE
FT                   ITDWEKPIYVKVGAARPYYDTALAVKSGADVVVVDGMQGGTAATQEIFIEHVGIPTLAA
FT                   VRQAVKALQDLGMHRKVQLIVSGGIRNGADVAKALALGADAVAIGTAALVALGDNDPHY
FT                   QAEYEALGTTAGAYDDWHEGRDPAGITTQDPALMARLDPVAAGRRLANYLAVLTLECQT
FT                   IARACGKSHVHNLEPEDLVALTIEAAAMAQVPLAGTDWVPGRNGSF"
     atgtcggacc acagcaacat tccgcgcacc aaaccccgcg cgtccgccac cttcgacgac        60
     tacacgctat cggaaatccg ccgcgccgcg gcgaccggca tctacgacat ccgcggcgcc       120
     ggtgcgaagc gcaaggtccc gcatttcgac gacctgctct tcctcggcgc ctccatgtcg       180
     cgctatccgc tggaaggcta tcgcgagaag tgctcgacgg aggtcgtgct cggcacccgc       240
     ttcgccaaga agccgatcga gctgaagatc ccgatcacca ttgccggaat gagcttcggc       300
     tcgctctcgg ccaatgccaa ggaagcgctc ggacgtggcg cctcggccat gggcacctcg       360
     accaccaccg gcgacggcgg catgaccaat gaggagcgcg ggcactccat ccagctcgtc       420
     taccagtacc tgccctcgcg ctatggcatg aaccccgacg acctcaagcg cgccgacgcc       480
     atcgaggtgg tggtcggcca gggcgccaag cccggcggcg gcggcatgct gctcggccag       540
     aagatcaccg agcgcgtcgc cgccatgcgc acgctgcccg tcggcatcga ccagcgctcc       600
     gcctgccgcc accccgactg gaccgggccg gacgacctcg agatcaagat cgaggagctg       660
     cgcgagatca ccgactggga gaagccgatc tatgtgaagg tcggcgccgc ccgcccctat       720
     tacgatacgg cgctggccgt gaagtcgggc gcggacgtgg tggtcgtcga cggcatgcag       780
     ggtggcaccg cggcgacgca ggagatcttc atcgagcatg tcggcatccc gacgctggcc       840
     gccgtccggc aggcggtgaa ggcgttgcag gacctcggca tgcaccgcaa ggtgcagctc       900
     atcgtctccg gcggcatccg caacggtgcc gacgtggcga aagccctggc gctcggcgcc       960
     gacgcggtgg cgatcggcac ggcggcgctg gtggcgctcg gtgacaatga tccgcactac      1020
     caggccgaat acgaggcgct gggcaccact gccggcgcct atgacgactg gcacgagggt      1080
     cgcgaccccg ccggcatcac cacgcaggac ccggcgctga tggcgcggct cgatcccgtc      1140
     gccgccggcc gccggctcgc caactacctc gccgtgctga cgctggagtg ccagaccatc      1200
     gcccgcgcct gcggcaagag ccacgtccac aatctcgagc ccgaggatct ggtggcgctc      1260
     accatcgagg ccgccgccat ggcccaggtg ccgctcgccg gcaccgactg ggtgccgggc      1320
     aggaatggaa gcttctga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page