(data stored in ACNUC1104 zone)

EMBL: CP002026.PE456

CP002026.PE456       Location/Qualifiers
FT   CDS_pept        475511..476905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0460"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: msl:Msil_3303
FT                   soluble pyridine nucleotide transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87793"
FT                   /db_xref="GOA:D7A375"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A375"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH87793.1"
FT                   /translation="MYDYDMIVIGSGPSGRRAAVQSAKIGKSVLVIEKGRRVGGVSVHT
FT                   GTIPSKTLRETVLNLSGWRERGFYGRAYRVKQDIGAGDLMARLHKTLDHEVEVLEHQFA
FT                   RNGVKNARGEARFLDPHTIEITGETGEIETVTGEHVLIAVGTKPFRPDYVPFNGMTVFD
FT                   SDEIVDLPKLPRSLAVIGAGVIGVEYATIFSALDVAVTLIEPRTSFLDFIDKELIEEFT
FT                   HELRDRNVGLRLGAAVTSITLGPDERPVCKLADGRTVQADMLLFAAGRVGATDRLNLDA
FT                   AGLNVDHRGRLKVDPKTLQTEVPHIYAAGDVIGFPSLASTSMEQGRVAACHAFGLEPPP
FT                   PPEFFPYGIYSVPEMSTVGMSEEEVRKREIPYECGIARFRETSRGHIMGLSNGMMKMIF
FT                   SVKTRRLLGVHIVGEGATELIHIGQAVLNLKGTIDYFIENTFNYPTLAEAYKIAGLDAW
FT                   NRMPRV"
     atgtacgact acgacatgat cgtcatcggc agcggtccct ccgggcgccg cgccgccgtg        60
     cagtccgcca agatcggcaa gtcggtgctg gtgatcgaga agggccgccg cgtcggcggc       120
     gtctcggtcc acaccggtac catcccctcg aagacgctgc gcgagacggt gctgaacctc       180
     tccggctggc gcgagcgcgg cttttatggc cgcgcctacc gggtaaagca ggacatcggc       240
     gccggtgacc tgatggcgcg gctgcacaag acgctcgacc acgaggtcga ggtgctggag       300
     catcagttcg cgcgcaacgg ggtgaagaac gcgcgcggcg aggcgcgctt cctcgacccg       360
     cacaccatcg agatcaccgg cgagaccggc gagatcgaga cggtgaccgg cgagcacgtc       420
     ctcattgccg tgggcaccaa gccgttccgc ccggattacg tgccgttcaa cggcatgact       480
     gtgttcgaca gcgacgagat cgtcgacctg cccaagctgc cgcgcagcct ggcggtgatc       540
     ggcgccgggg tgattggggt cgaatacgcc acgatcttca gcgcactgga tgtcgcggtg       600
     acgctcatag agccgcgcac gagcttcctc gacttcatcg acaaggagct gatcgaggaa       660
     ttcacccatg agctgcgcga ccgcaatgtc ggcctgcgcc tcggcgcggc ggtcacctcg       720
     atcacactcg gccccgatga acgcccggtg tgcaagctgg ctgacgggcg caccgtgcag       780
     gcggacatgc tgctcttcgc cgccggccgc gtcggcgcca ccgaccggct gaacctcgac       840
     gcggcggggc ttaacgtcga ccatcgcggg cggctgaagg tcgatccgaa gacgctgcag       900
     accgaggtgc cgcacatata cgccgccggc gacgtgatcg gcttccccag cctcgcctcc       960
     acctcgatgg agcagggccg cgtcgccgcc tgccacgcct tcggcctgga gccgcctccg      1020
     ccgccggagt tcttccccta tggcatctat tcggtgccgg agatgtcgac ggtcggcatg      1080
     agcgaggagg aggtgcgcaa gcgcgagatc ccctatgagt gcggcatcgc ccgcttccgc      1140
     gagacctcgc gcggccacat catggggctg agcaacggca tgatgaagat gatcttctcg      1200
     gtgaagacgc gccgtctgct cggcgtgcac atcgtcggcg agggcgcgac cgagctgatc      1260
     cacatcggcc aggcggtgct caacctgaag ggcacgatcg actatttcat cgagaacacg      1320
     ttcaactacc caacgctcgc cgaggcctac aagatcgccg gcctcgacgc atggaaccgc      1380
     atgccgcggg tctag                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page