(data stored in ACNUC1104 zone)

EMBL: CP002026.PE460

CP002026.PE460       Location/Qualifiers
FT   CDS_pept        complement(479348..482329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0464"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /note="KEGG: azc:AZC_1494 sarcosine oxidase alpha subunit;
FT                   TIGRFAM: sarcosine oxidase, alpha subunit family; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   HI0933 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87797"
FT                   /db_xref="GOA:D7A379"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:D7A379"
FT                   /inference="protein motif:TFAM:TIGR01372"
FT                   /protein_id="ADH87797.1"
FT                   /translation="MSRAQRNRLDAGGLIDRSQVLDFFFDGRRYRGHAGDTLASALLAN
FT                   GVRLVGRSFKYHRPRGIFSAGAEEPNALVELRDGGRREPNTRATVAELYDGLEATSQNR
FT                   WPSLGLDVLSVNRLVSPFLGAGFYYKTFMWPAKAWEKLYEPFIRRAAGLGRAAEGNDPD
FT                   HYEKATTFCDVLVIGAGPAGLMAALAAGRTGARVILADEDFLPGGRLNAEVHEIGGQPG
FT                   AAYAAHVAAELASLPNVRVMPRTTVFGVYDGGTYGALEKVGDHLRVPAPFQPRHRFWRI
FT                   VARRAVLAAGATERPIVFGGNDRPGVMLAGAVGTYVQRFAVRPGRHVALFANNDAAWRG
FT                   MLAAQAAGANVEAIVDVRGDVASVLTEAAKAKGIRIFTGARVIATHGKKLRTIDVAASG
FT                   RGRETLYIDTLAVSGGWSPAVHLTCHHGGKPVWNEAVAAFVPGSTPPGLAVAGAANGSF
FT                   ALGAILKEGAQQGAEAAEALGFPVPPLDVPHTSEESTALKPFWHVADSKGAAFVDLQND
FT                   VTAKDVGIAHREGFRSVEHLKRYTTLGMATDQGRTSNVTGLAIMAELTGASIAETGTTI
FT                   FRPPYTPVSLGALAGHHRGKDFRPVRLTPTHEWAARQGAVFVETGPWLRAQYFPRKGEK
FT                   DWLETVTREVKAVRSSVGLIDVSTFGKIDLQGPDVGAFLDRVYINTFSTLAVGKARYGV
FT                   MLREDGMVMDDGTTARLAPEHYVMTTTTANAAKVFQHLEFCLQVLWPELDVSLASVSEH
FT                   WAQIAIAGPVARTVLSRVVDKGVDVSDAALPFMGAIEGTVMGGVKARLFRLSFSGELGY
FT                   EIAVPARQGAKLAQALMQAGHEYGITPYGTEALGVMRIEKGHVSGNELSGQTTAGDLGL
FT                   GRMASAKKDYIGRVMAGRPGLVDPDRPSLVGFRPADRTKRLRAGAHFLGLGAPADTAHD
FT                   EGYMTSVAYSPQLGHWIGLGLLKGGAKRIGDRVRAYDPVRGEEFELEVCAPAFIDPQGE
FT                   RLRG"
     atgagccgcg cccagcgcaa ccgtctcgat gccggcggcc tgatcgaccg ctcgcaggtg        60
     ctcgacttct tcttcgacgg ccgccgctat cgtggccatg ccggcgacac gctggcctcg       120
     gcgctgctgg cgaacggcgt gcgcctggtc ggccgctcgt tcaagtacca tcgcccgcgc       180
     ggcatcttct ccgccggcgc ggaggagccg aacgcgctgg tcgagctgcg cgacggcggc       240
     cggcgcgagc ccaacacccg cgccaccgtc gccgagctct atgacgggct ggaggcgacc       300
     agccagaacc gctggccctc gctcggcctc gacgtgctga gcgtgaaccg gctcgtttcg       360
     cccttcctcg gcgccggctt ctattacaag accttcatgt ggccggcgaa ggcgtgggag       420
     aagctctacg agcccttcat ccgccgcgcc gccggcctcg gccgcgcagc cgaaggcaat       480
     gaccccgacc attatgagaa ggccaccacc ttctgcgacg tgctggtgat cggcgccggc       540
     ccggccgggc tgatggcggc gctcgccgcc gggcgcaccg gcgcccgcgt catcctcgcc       600
     gacgaggact tcctgcccgg cggtcgcctg aatgccgagg tccacgagat cggcgggcag       660
     ccgggcgccg cctacgccgc ccatgtcgcc gccgagctgg cgagcctgcc caatgtgcgg       720
     gtgatgcctc gcaccaccgt gttcggcgtc tatgacggcg gcacctatgg cgcgctggag       780
     aaggtgggcg atcatctgcg cgtgccggcg cccttccagc cgcgccacag gttctggcgt       840
     atcgtggcgc ggcgcgccgt gctggcggcc ggcgccaccg agcggcccat cgtcttcggc       900
     ggcaatgacc gaccgggcgt gatgctggcc ggcgcggtcg gcacctatgt gcagcgcttc       960
     gccgtgcggc cgggccgaca cgtcgccctc ttcgccaata acgacgccgc ctggcgcggc      1020
     atgctggcgg cgcaggccgc cggcgccaat gtcgaggcca tcgtcgatgt gcgcggcgac      1080
     gttgcctcag tgctgaccga ggctgcgaag gcgaagggca tccggatctt caccggcgcg      1140
     cgcgtgatcg ccacccacgg caagaagctg cgcaccatcg acgtcgccgc ctccgggcgc      1200
     gggcgcgaaa cgctctatat cgacacgctc gccgtctccg gcggctggtc gccggccgtc      1260
     cacctcacct gccatcacgg cggcaagccg gtgtggaacg aggccgtcgc ggccttcgtg      1320
     cccggcagca cgccgcccgg cctcgcggtc gccggcgcgg cgaatggcag cttcgccctg      1380
     ggcgccatcc tgaaggaagg cgcgcagcag ggcgccgaag ccgcggaggc gctcggcttc      1440
     ccggtgccgc cgctcgacgt gccgcatacg agcgaggaaa gcaccgccct caagcccttc      1500
     tggcatgtgg cggactcgaa gggggccgcc ttcgtcgacc tgcagaacga cgtcaccgcc      1560
     aaggatgtcg gcatcgccca tcgcgagggc ttccgctcgg tcgagcatct caagcgttat      1620
     acgacgctcg gcatggcgac cgaccagggc cgcacctcca atgtcaccgg cctcgccatc      1680
     atggccgagc tgaccggcgc ttccatcgcc gagaccggca cgacgatctt ccgcccgccc      1740
     tacacgcccg tctccctggg cgcgctggcc gggcatcacc ggggcaagga ttttcgcccc      1800
     gtgcgcctga cgcccaccca tgaatgggcg gccaggcagg gcgcggtctt cgtcgagacc      1860
     ggcccgtggc tgcgcgcgca atatttcccg cgcaagggcg agaaggactg gctggagacc      1920
     gtcacccgcg aggtcaaggc ggtgcgctcg tcggtcgggc tgatcgacgt ctcgaccttc      1980
     ggcaagatcg acctgcaagg cccggacgtc ggcgccttcc tcgaccgcgt ctacatcaac      2040
     accttctcga cacttgccgt cggcaaggcg cgctacggcg tcatgctgcg cgaggacggc      2100
     atggtgatgg acgacggcac caccgcccgg ctggcgcccg agcactatgt gatgaccacg      2160
     accacggcga acgccgccaa ggtcttccag catctcgaat tctgcctgca ggtgctgtgg      2220
     ccggaactcg acgtctcgct cgcctcggtc tccgagcact gggcgcagat cgccatcgcc      2280
     ggcccggtgg cgcgcaccgt gctgtcccgc gtcgtcgaca agggcgtcga tgtgtccgat      2340
     gccgccctgc ccttcatggg cgcgatcgaa ggcacggtga tgggcggggt gaaggcgcgc      2400
     ctcttccgcc tctccttctc cggcgagctc ggctatgaga tcgccgtgcc ggcccggcag      2460
     ggagcgaagc tggcgcaggc gctgatgcag gccggccacg aatacggcat caccccctac      2520
     ggcaccgagg cgctcggcgt gatgcgcatc gagaagggcc acgtctccgg caacgaattg      2580
     tccggccaga ccacggccgg cgatctcggc ctcggccgca tggcctcggc caagaaggat      2640
     tatattggcc gcgtcatggc cggccggccg ggcctcgtcg accccgaccg cccgagcctc      2700
     gtcggcttcc ggccggcgga ccggacgaag cgcctgcgcg caggcgcgca tttcctcggc      2760
     ctcggcgcgc cggccgacac ggcgcatgac gagggctaca tgacctccgt cgcctattca      2820
     ccgcagctcg gccactggat cggcctcggc ctgctcaagg gcggggcgaa acgcatcggc      2880
     gaccgggtgc gcgcctatga cccggtgcgc ggcgaggaat ttgagctaga ggtctgcgcg      2940
     ccggccttca tcgatccgca aggggagcgt ctgcgtggct ga                         2982
//

If you have problems or comments...

PBIL Back to PBIL home page