(data stored in ACNUC1104 zone)

EMBL: CP002026.PE461

CP002026.PE461       Location/Qualifiers
FT   CDS_pept        complement(482326..482610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0465"
FT                   /product="Sarcosine oxidase delta subunit heterotetrameric"
FT                   /note="PFAM: Sarcosine oxidase delta subunit
FT                   heterotetrameric; KEGG: azc:AZC_1495 sarcosine oxidase
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87798"
FT                   /db_xref="GOA:D7A380"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:D7A380"
FT                   /inference="protein motif:PFAM:PF04267"
FT                   /protein_id="ADH87798.1"
FT                   /translation="MRIPCPYCGERDAHEFAYLGDATPARPDPAAEDAEQRFHDYVYLR
FT                   DNPAGAHIEWWYHANGCRQWLKVERDTRTHAIAGARAAREADTPAGDAA"
     atgcgcattc cctgccccta ttgcggcgag cgcgacgccc acgagttcgc ctatctcggc        60
     gacgccacgc cggcgcggcc cgatcccgcc gccgaggacg cggagcagcg cttccacgac       120
     tacgtctacc tgcgcgacaa cccggccggc gcccacatcg agtggtggta ccacgccaat       180
     ggctgccgcc agtggctgaa ggtcgagcgc gacacccgca cccatgccat cgccggcgcc       240
     cgcgccgcgc gcgaggccga cacgccggcg ggagacgccg catga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page