(data stored in ACNUC1104 zone)

EMBL: CP002026.PE462

CP002026.PE462       Location/Qualifiers
FT   CDS_pept        complement(482610..483860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0466"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="KEGG: azc:AZC_1496 sarcosine oxidase beta subunit;
FT                   TIGRFAM: sarcosine oxidase, beta subunit family; PFAM: FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87799"
FT                   /db_xref="GOA:D7A381"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A381"
FT                   /inference="protein motif:TFAM:TIGR01373"
FT                   /protein_id="ADH87799.1"
FT                   /translation="MHYSWLSILKNGLTGQKGWTPAWRDAAPKPSYDVIIVGGGGHGLA
FT                   TAYYLAKVHGIHNVAVIEKGYIGSGNAGRNTTIIRSNYLLPGNEPFYEWSMKLWEGLEQ
FT                   ELNYNAMVSQRGILNLFHSDAQRDAYARRGNAMRLAGADSELLDQRQVRAMYPFLDFDN
FT                   TRFPVQGGLLQRRGGTARHDAVVWGYARAADRLGVDIIQNCEVTGFLREGEAIVGVETS
FT                   RGPIRSAKVGLAVAGSSSRVAQKAGLRLPIESHVLQAFVSEGLKPLIDGVITFGAGHFY
FT                   ISQSDKGGLVFGGDIDGYNSYAQRGNLPVIEDVAESGMALMPRIGRLRLLRMWGGIMDM
FT                   SMDGSPIIDRAPVPGLYLNAGWCYGGFKATPASGWCFAHLLAKDEFHDVGGAYRLDRFR
FT                   TGHLIDEKGVGAQPNLH"
     atgcattatt cctggctcag catcctcaag aacggcctca ccgggcagaa gggctggacg        60
     cccgcctggc gcgacgccgc gcccaagccc tcctatgacg tgatcatcgt cggcggcggc       120
     ggccacgggc tggcaacggc ctactatctc gccaaggtcc acggcatcca caacgtggcg       180
     gtgatcgaaa agggttatat cggctccggc aatgccgggc ggaacaccac catcatccgc       240
     tccaactacc tgctgccggg caacgagccg ttctacgaat ggtcgatgaa gctctgggaa       300
     gggctggagc aggagctgaa ctacaacgcg atggtcagcc agcgcggcat cctgaacctc       360
     ttccattccg acgcccagcg cgacgcctat gcgcggcgcg gcaatgccat gcggctggcg       420
     ggggcggatt cggagctgct ggaccagcgg caggtgcggg ccatgtaccc gttcctcgac       480
     ttcgacaata cccgtttccc cgtacagggc ggcctgctcc agcgccgcgg cggcaccgcc       540
     cgccacgacg cggtggtctg gggctatgcc cgtgccgccg accggctcgg cgtcgacatc       600
     atccagaact gcgaggtcac gggcttcctg cgcgagggcg aggcgatcgt cggcgtcgag       660
     acctcccgcg ggccgatccg ttcggccaag gtgggccttg cggtcgccgg ctcgtcctcg       720
     cgcgtggcac agaaggccgg ccttcgcctg ccgatcgaga gccacgtcct gcaggccttc       780
     gtctccgagg ggctgaagcc gctgatcgac ggcgtcatca ccttcggcgc cgggcatttc       840
     tacatctcgc agtccgacaa gggcggcctc gtcttcggcg gcgacatcga cggctacaat       900
     agctacgccc agcgcggcaa cctccccgtg atcgaggacg tcgccgagag cggcatggcg       960
     ctgatgcccc gcatcggccg gctgcggctg ctgcgcatgt ggggcggcat catggacatg      1020
     tcgatggacg gctcgcccat catcgaccgc gcgccggtgc ccggcctcta tctcaatgcc      1080
     ggctggtgct atggcggctt caaggccacc ccggcctcgg gctggtgctt cgcgcatctg      1140
     ctggcgaagg acgaattcca cgatgtcggc ggcgcctacc ggctcgaccg cttccgcacc      1200
     ggccatctca tcgacgagaa gggagtcggc gcccagccga acctgcactg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page