(data stored in ACNUC1104 zone)

EMBL: CP002026.PE463

CP002026.PE463       Location/Qualifiers
FT   CDS_pept        483964..484935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0467"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: xau:Xaut_4699 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87800"
FT                   /db_xref="GOA:D7A382"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A382"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADH87800.1"
FT                   /translation="MAQPDTLPFDLRSLELFLAVCDAGTMAQAARRLGLTQPAISQAVA
FT                   EMERRMGVALFDRSARPLALTAAGGALRQRASALLSEARQIAPLLREAERARLPLIRTG
FT                   IVDSLSRVLIAPLVRALAEKAEQVSLLSGLTAAHAGALLTRQLDLLVGADALDEIEGLE
FT                   RWPLLTEPYVLLMPANLPAPSRVADIEELTRTVPLVRFSARSKTGMEVERHLRRLRLEL
FT                   PRPLEFDTPYGVTAAVADGAGFAVTTPLCLIEAAVPLDGLACHALPGPGLARHLTLIAR
FT                   RQELGRLPREIAAFCRERLLASKPAVAALVGEGLAEGFRVEP"
     atggcacagc ccgacaccct tcccttcgac ctgcgttcgc tggagctgtt cctcgccgtc        60
     tgcgacgccg gcaccatggc gcaggcggcg cgccggctcg ggctgacgca gccggcgatc       120
     tcgcaggcgg tggccgagat ggagcggcgc atgggcgtcg cgctgttcga ccgcagcgcc       180
     cggccgctcg ccctcaccgc cgccggcggg gcgctgcgcc agcgggcgag tgcgctgctc       240
     tccgaggcgc ggcagatcgc gccgctgctg cgcgaggcgg aacgggcgcg gctgccgctg       300
     atccgcacgg ggatcgtgga ttcgctctcg cgcgtgctga tcgcgccgct ggtgcgggcc       360
     ctggccgaga aggcggagca ggtgtcgctg ctttccggcc tcaccgccgc ccatgccggg       420
     gcgctgctga cgcgccagct cgacctgttg gtcggtgccg acgcgctcga cgagatcgag       480
     gggctggagc gctggccgct gctcaccgag ccctatgtgc tgctgatgcc ggcgaacctg       540
     cccgcgcctt cgcgggtcgc cgacatcgag gaactgaccc gcaccgtgcc gctggtgcgc       600
     ttctccgccc gctccaagac cggcatggag gtggagcggc atctgcgccg gctgcggctc       660
     gaactgccgc gcccgctgga gttcgacacg ccttatgggg tgacggcggc ggtggcggat       720
     ggggccggct tcgccgtgac cacgccgctg tgcctgatcg aggccgccgt gccgctggac       780
     gggctcgcct gccatgcgct gcccggtccg gggctggcgc ggcacctcac tttgatcgcc       840
     cgccgccagg agctcggccg cctgccgcgc gagatcgccg ccttctgccg cgagcggctg       900
     ttggcgtcga agccggcggt cgcggcgctg gtgggggagg ggctggccga ggggttcagg       960
     gtcgagccgt ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page