(data stored in ACNUC1104 zone)

EMBL: CP002026.PE465

CP002026.PE465       Location/Qualifiers
FT   CDS_pept        complement(486153..486422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0469"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87802"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D7A384"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ADH87802.1"
FT                   /translation="MQTDDPAVAEIVDFISGEVGVDSNLLTPETPVSELGISSLDLIET
FT                   IFKLESRFGIEIPNDGPLSGNDVTVGTLVQHVAELLAAQKAKTA"
     atgcagacag acgatcccgc cgttgctgaa atcgtcgact tcatctccgg cgaggtcggg        60
     gtcgattcga acctgctgac ccccgagacg ccggtttccg agctcggcat ctcctcgctc       120
     gacctgatcg agaccatctt caagctggaa agccgcttcg gcatcgagat acccaatgac       180
     ggcccgctga gcggcaatga cgtgaccgtc ggcacactcg tccagcacgt cgccgagctg       240
     ctcgcggcgc agaaggccaa gaccgcctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page