(data stored in ACNUC1104 zone)

EMBL: CP002026.PE467

CP002026.PE467       Location/Qualifiers
FT   CDS_pept        complement(488070..489404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0471"
FT                   /product="Gluconate transporter"
FT                   /note="PFAM: Gluconate transporter; KEGG: tle:Tlet_1725
FT                   gluconate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87804"
FT                   /db_xref="GOA:D7A386"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D7A386"
FT                   /inference="protein motif:PFAM:PF02447"
FT                   /protein_id="ADH87804.1"
FT                   /translation="MYLTYAAIFVAVVAVFALLTARGRVHAFLALVAAAFAFNWGIGWS
FT                   LGYVVKSFGTGFSQSLAALGLVVVAGALMAEIADGTGATARLQQMARGWRRRSPPLALL
FT                   GLIGGMGSTPGAAFAVLDPLRRGIGGDSPRSALVLGLSLSAGHGLLIPAPVMLANLTIL
FT                   RGDWLLAAFIGLPAAILCVLLGMFFARLAATDAPRPVDTAESIGGETLHAPRRGALALL
FT                   VTSLVLIALLIVQSLGDIASEPFGGGNDRLFILALGSPMLLVAVGVGLLLLLSWNWEPG
FT                   GLGEEGWAARAFARVAPLLLIVGAAGGLAKVVQDTGTAEMVAETAIDLLPAHGALALLV
FT                   PFALAAIVKTLQGSSLVAAITAAGMMMELLAPLGLDDPTGRTLAALAVGAGAMTVSQIN
FT                   DGFFWLVARAGGFTPPAALARLSVGTALQGALAVAVLMLFRLIAG"
     atgtacctga cctacgccgc catcttcgtc gccgtcgtgg ccgtcttcgc gcttctcacg        60
     gcgcgcggca gggtccatgc cttcctcgcc ctcgtggccg ccgccttcgc cttcaactgg       120
     ggcatcggct ggtcgctggg ctatgtggtc aagagcttcg gcaccggctt cagccagtcg       180
     ctagcggcgc tcggcctcgt cgtggtggcg ggggcgctga tggccgagat cgccgacggc       240
     accggcgcca cggcgcggct gcagcagatg gcgcgcggct ggcgccggcg ttcgccgccg       300
     ctcgcactgc tcgggctgat cggcggcatg ggctcgacgc cgggcgccgc cttcgcggtg       360
     ctcgacccgc tgcggcgcgg catcggcggc gacagcccgc gctccgctct ggtgctcggc       420
     ctgtcgctct cggccggcca tggccttctc atccccgccc cggtgatgct ggcgaacctc       480
     accatattgc gcggcgactg gcttctcgca gcgttcatcg gcctgccggc ggccatcctc       540
     tgcgtgctgc tcggcatgtt cttcgcccgc ctcgccgcca ctgacgcgcc ccgcccggtc       600
     gacacggcgg agagcatcgg cggcgagacc ctgcacgcac cccgccgcgg cgcgctggcg       660
     ctactcgtca ccagcctcgt gctgatcgcg ctgctgatcg tgcagtcgct cggcgacatc       720
     gcctccgagc cgttcggcgg tggcaatgac cgcctcttca tcctcgccct cggcagcccg       780
     atgctgctgg tggcggtggg cgtcggcctg ctcctgctgc tgagctggaa ctgggagccc       840
     ggcgggctcg gcgaggaggg ctgggcggcc cgcgccttcg cccgggtcgc gccgctgctg       900
     ctcatcgtcg gcgcggccgg cggcctggcg aaggtggtgc aggacaccgg caccgccgag       960
     atggtggccg agacggcgat cgacctcctg cccgcccacg gcgcgctcgc gctgctcgtg      1020
     cccttcgcgc tcgccgcgat cgtcaagacg ctgcagggct cgtccctcgt cgccgccatc      1080
     accgccgcgg gcatgatgat ggagcttctc gccccactcg gcctcgacga ccccaccggc      1140
     cggacgctgg ccgcgctcgc cgttggggcc ggcgccatga cggtgtcgca aataaatgac      1200
     ggattctttt ggctcgttgc ccgcgccggc ggctttacgc ccccagcggc gctcgcgcgc      1260
     ctgtcggtcg gcaccgcgct gcagggcgcg ctcgccgtcg ccgtgctgat gctgttccgg      1320
     ctcatcgccg gatag                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page