(data stored in ACNUC1104 zone)

EMBL: CP002026.PE469

CP002026.PE469       Location/Qualifiers
FT   CDS_pept        490903..492417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0473"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   met:M446_6034 malonyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87806"
FT                   /db_xref="GOA:D7A388"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7A388"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADH87806.1"
FT                   /translation="MTNHLFDTLRAGQPEGGRVFIATPEGAVFTYADMERRAAQYANAL
FT                   VSLGVKPGDRVALQVEKSVEAIFAYLGTVRAGGVFLPLNTAYTAPEIDYFLGDAEPAVF
FT                   VCDPAAEATLAPIARARGVAHLFTLDADGKGTLSAAADAAAANFEDVERGPDDLAALLY
FT                   TSGTTGRSKGAMLTHDNLASNALALVDTWRFGPEDVLIHALPIFHTHGLFVATNVILAA
FT                   GASMIFLPKFDPEAILRLMGRASVMMGVPTFYTRLLKAPGLTPEAAAKMRLFISGSAPL
FT                   LADTHREWRARTGHAILERYGMTETGMNTSNPYDGERIAGTVGMPLPGVSLRVVAPDDG
FT                   TELGAGEIGMIEVRGPNVFKGYWRMPEKTAAEFHDGWFVTGDLGLIGPDGYVQIVGRGK
FT                   DLVISGGYNVYPKEIESEIDALDGVVESAVIGLPHADFGEGVTAVVVARPDAALDEKAV
FT                   VAALEGRLARYKLPKRVIFVDDLPRNTMGKVQKNLLREQYKALYAG"
     atgaccaacc atctgttcga caccctccgg gctggccagc cggagggcgg gcgcgtgttc        60
     atcgcgacgc cggagggcgc cgtcttcacc tatgccgaca tggagcggcg ggcggcgcag       120
     tacgccaatg cgctggtttc gctgggcgtg aagcccggcg accgggtggc gctgcaggtg       180
     gagaagagcg tcgaggcgat cttcgcctat ctcggcacgg ttcgagccgg cggcgtgttc       240
     ctgccgctga acaccgccta tacggcgccg gagatcgact atttcctcgg cgatgccgag       300
     ccggcggtct tcgtctgcga tccggcggcc gaggcgacgc tggcgccgat cgcaagggcg       360
     cggggcgtcg cgcatctgtt caccctcgac gccgacggca agggaaccct gagcgcggcg       420
     gcggacgcgg cggcggcgaa cttcgaggac gtagagcgcg ggccggacga cctcgccgcg       480
     ctgctctata cgtcgggcac caccgggcgc tccaagggcg ccatgctcac ccatgacaac       540
     ctcgcctcca acgcgctggc gctggtcgac acctggcgct tcgggccgga ggacgtgctg       600
     atccacgccc tgccgatctt ccacacgcac ggcctgttcg tcgccaccaa tgtgatcctg       660
     gcggccggcg cgtcgatgat cttcctgccg aagttcgacc ccgaggcgat cctcaggctg       720
     atgggccggg cgagcgtcat gatgggggtg ccgaccttct acacccgcct gctcaaggcg       780
     cccggcctca cccccgaggc ggcggcgaag atgcggctgt tcatctccgg ctcggcgccg       840
     cttctggccg acacgcaccg cgaatggcgg gcgcggacgg gccacgccat cctcgaacgc       900
     tacggcatga ccgagaccgg catgaacacc tccaacccct atgacggcga gcgcatagcc       960
     ggcacggtcg gcatgcccct gccgggggtg agcctgcgcg tcgtcgcgcc cgacgacggg      1020
     acggaactcg gcgccggcga gatcggcatg atcgaggtga gggggccgaa cgtcttcaag      1080
     ggctactggc gcatgccgga gaagaccgcc gccgaatttc atgacggctg gttcgtcacc      1140
     ggcgacctcg ggctgatcgg cccggatggc tatgtgcaga tcgtcgggcg cggcaaggac      1200
     ctcgtgatct ccggcggcta caacgtctac cccaaggaga tcgagagcga aatcgacgcg      1260
     ctggacggcg tggtcgagag cgcggtgatc ggcttgccgc acgccgattt cggcgagggg      1320
     gtgacggcgg tggtggtcgc ccgccccgac gcggcgctgg acgagaaggc ggtggttgcg      1380
     gcgctggagg ggcggcttgc ccgctacaag ctgcccaaac gggtgatctt cgtcgacgac      1440
     ctgccgcgca acaccatggg caaggtgcag aagaacctgc tgcgcgagca gtacaaggcg      1500
     ctctacgcgg ggtga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page