(data stored in ACNUC1104 zone)

EMBL: CP002026.PE47

CP002026.PE47        Location/Qualifiers
FT   CDS_pept        complement(35683..38481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0047"
FT                   /product="UTP-GlnB uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   TIGRFAM: protein-P-II uridylyltransferase; KEGG:
FT                   azc:AZC_0338 PII uridylyl-transferase; PFAM: GlnD
FT                   PII-uridylyltransferase; DNA polymerase beta domain protein
FT                   region; metal-dependent phosphohydrolase HD sub domain;
FT                   amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87384"
FT                   /db_xref="GOA:D6ZZX0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX0"
FT                   /inference="protein motif:TFAM:TIGR01693"
FT                   /protein_id="ADH87384.1"
FT                   /translation="MTDTRRRRRTDHPFKELFDIDVLREELTALARQVLDNGKAGREIE
FT                   LRGQMARRLKLAYQQGHKTAERWLMEEGSGRRCAERLSRLQDEIIALVHELAVKFLYPS
FT                   DNPSTAERMAIVAVGGYGRGLMAPGSDTDILFLLPYKQTAWGESVAEAILYVLWDMGLK
FT                   VGHATRSVDECIRQARADMTIRTALLEARLLLGEKSLFEELTVRFDKEVVQGTAVEFVA
FT                   AKLAEREDRLKRAGQSRYVVEPNVKDGKGGLRDLHTLFWIAKYVYRVHETRDLVAKGVF
FT                   TPEEAVVFRRCEDFLWSVRCHLHFLAGKAEERLSFDLQREMAERLGYTAHPGLKDVERF
FT                   MKHYFLVAKDVGDLTAIVSAALEERHDKPVPRLNRVIARLRRSPRRALKESTDFIVDND
FT                   RINVADASAFGRDPVNLIRIFHLAGKHGLAFHPDAMRLATRSLKLIDQRVRENPEANKL
FT                   FLEILCSRETPEIVLRRMNETGVLGRFIPEFGRVVAMMQFNMYHSYTVDEHLIRAIGVL
FT                   GQIERGDRPDLGLANELVQQIKNRTLLYVAVFLHDIAKGRPEDHSIAGARVARKLCPRF
FT                   GLSPVDTDTVAWLIEQHLTMSTIAQSRDLSDRKTIENFASVVQNLERMKLLLILTTADI
FT                   RAVGPGVWNNWKSQLLRTLYYETEPVITGGFSESNRNQRVARAQAEFRAAMADWPPEEI
FT                   EAYLSRHYQTYWLQTDREQQAEHARFIRAAEAEGRALATTAHTDAARGVTELTVFAPDH
FT                   PKLLAVIAGACASAGAHIVDAQISTTTDGRALDTISLTRAFEQDSDELRRTERIAAAIQ
FT                   KSLAGEIRLPEIVAKRIPKRPRAFTVEPEVTLNNSWSNRHTVVEVSGLDRPGLLYGLTQ
FT                   TLSRLNLNIASAHIATFGERAVDVFYVTDLMGAKIIGAARHSAIRRALLQVLDADDEAN
FT                   AA"
     atgaccgata cccgccgacg ccgccgcacc gaccatccct ttaaggaatt gttcgatatc        60
     gacgtcctgc gcgaggagct caccgccctc gcccggcagg tgctggacaa tggcaaggcg       120
     ggccgcgaga tcgagctgcg tggccagatg gcccggcggc tcaagctcgc ctaccagcag       180
     ggccacaaga ctgccgagcg ctggctgatg gaggagggct cgggccggcg ctgcgccgag       240
     cggctctcgc ggctgcagga cgagatcatc gctctcgtgc acgagctggc ggtgaagttc       300
     ctctacccgt ccgacaatcc ctccaccgcc gagcgcatgg ccatcgtcgc cgtcggcggc       360
     tatggccgcg ggctgatggc gccgggctcg gacaccgaca tcctgttcct gttgccctac       420
     aagcagaccg cctggggcga gagcgtcgcc gaggcgatcc tctacgtgct ctgggacatg       480
     gggctgaagg tcggccacgc gacgcgctcg gtcgacgagt gcatccgcca ggcgcgcgcc       540
     gacatgacca tccgcacggc gctgctggaa gcacggctgc tgctcggcga gaagagcctg       600
     ttcgaggaac tcaccgtccg cttcgacaag gaagtggtgc agggcaccgc cgtcgagttc       660
     gtcgccgcca agctcgccga gcgcgaggac cggctgaagc gtgccggcca gtcgcgctat       720
     gtggtcgagc cgaacgtcaa ggacggcaag ggcggcctgc gcgacctgca cacgctgttc       780
     tggatcgcca aatacgtcta ccgcgtgcac gagacccgcg acctcgtcgc caagggcgtg       840
     ttcacgcccg aggaggcggt ggtgttccgc cgctgcgagg acttcctctg gtcggtgcgc       900
     tgccatctgc acttcctcgc cggcaaggcg gaggaacgcc tctccttcga tctgcagcgc       960
     gagatggccg agcggctcgg ctacacggcc catccgggcc tgaaggacgt cgagcgcttc      1020
     atgaagcact acttcctcgt ggccaaggac gtcggcgacc tcaccgccat cgtctcggcg      1080
     gcgctggagg aacggcacga caagccggtg ccgcggctca accgggtgat cgcccggctg      1140
     cgccgctcgc cgcgccgcgc gctgaaggaa agcaccgact tcatcgtcga caatgaccgc      1200
     atcaacgtcg ccgacgccag cgccttcggc cgcgatccgg tcaacctgat ccgcatcttc      1260
     cacctcgccg gcaagcacgg cctcgccttc catccggacg cgatgcgcct cgccacgcgc      1320
     tcgctgaagc tgatcgacca gcgcgtgcgc gagaacccgg aggcgaacaa gctcttcctt      1380
     gagatcctgt gctcgcgcga aacgccggaa atcgtgctgc ggcggatgaa cgagaccggc      1440
     gtgctcggcc gcttcatccc ggaattcggc cgcgtcgtgg cgatgatgca gttcaacatg      1500
     taccactcct acacggtgga cgagcatctc atccgcgcca tcggcgtgct cgggcagatc      1560
     gagcgcggcg accggcccga cctcggcctc gccaacgaac tggtgcagca gatcaagaac      1620
     cgcaccctgc tctatgtcgc ggtgttcctg cacgacatcg ccaagggtcg accggaggac      1680
     cactcgatcg ccggcgcccg cgtcgcccgc aagctgtgcc cgcgcttcgg cctaagcccg      1740
     gtcgacaccg acacggtggc gtggctgatc gagcagcacc tcaccatgtc gaccatcgcc      1800
     cagtcgcgcg acctctccga ccgcaagacc atcgagaact tcgccagcgt ggtgcagaac      1860
     ctcgagcgca tgaagctgct gctcatcctc accacggccg acatccgcgc ggtcggtccc      1920
     ggcgtgtgga acaactggaa gtcccagttg ctgcgcacgc tctattacga gaccgagccg      1980
     gtgatcaccg gcggcttctc cgagagcaac cgcaaccagc gcgtcgcccg cgcgcaggcc      2040
     gagttccgcg ccgccatggc cgattggccg ccggaggaga tcgaggccta tctctcccgc      2100
     cactaccaga cctactggct gcagaccgac cgggagcagc aggccgagca tgcccgcttc      2160
     atccgcgccg ccgaggcgga gggccgcgcg ctcgccacca ccgcccacac ggatgcagcc      2220
     cgcggcgtca ccgagctcac cgtcttcgcc cccgaccacc ccaagctgct cgccgtcatc      2280
     gccggggcct gtgccagcgc cggggcgcac atcgtcgacg cgcagatcag cacgacgacg      2340
     gacgggcgcg ctctcgacac catctcgctc acccgcgcct tcgagcagga ttccgacgag      2400
     ctgcgccgca ccgagcgcat cgccgcggcg atccagaagt cgcttgccgg cgagatccgg      2460
     ctgccggaga tcgtcgccaa gcgcatcccc aagcgcccgc gcgccttcac cgtcgagccc      2520
     gaggtgacgc tgaacaacag ctggtccaac cgccacaccg tggtcgaggt ctccggcctc      2580
     gaccggcccg gcctgctcta cgggctgacg cagacgctgt cgcggctgaa cctcaacatc      2640
     gcctcggcgc acatcgccac cttcggcgag cgggcggtgg acgtgttcta cgtcaccgac      2700
     ctgatgggcg cgaagatcat aggcgccgcc cgccactccg ccatccgccg ggcgctcttg      2760
     caggtgctcg acgccgacga cgaggcgaac gcggcgtag                             2799
//

If you have problems or comments...

PBIL Back to PBIL home page