(data stored in ACNUC1104 zone)

EMBL: CP002026.PE473

CP002026.PE473       Location/Qualifiers
FT   CDS_pept        complement(495994..497220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0477"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mdi:METDI1124 putative FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87810"
FT                   /db_xref="GOA:D7A392"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A392"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH87810.1"
FT                   /translation="MSRQEGIVIVGAGQGGFQAAASLREAGFTGPVTLVGEEPGLPYQR
FT                   PPLSKAYMKGDAGIEQIELRPAAFFADHDIQIVNARAEAIDRAAQRVVLEGGEALPYAH
FT                   MILATGARNRPLPVPGRELAGVYYLRSHADADALRERLEGARRVVVIGAGFIGLEFAAV
FT                   ARTLGHEVTVIEAAARPLARAVSPEMSAFFADAHTSMGTSLLLGAGVIGLIGAAGHVTG
FT                   VETTDGMVHPADFVVVGIGVTPNVELAAEAGLEVANGIVVDAHLSTMDPAISAIGDAVA
FT                   YPSRFADGLVRLESVQNAVDQAKAVAARLTGRPAPYAAVPWFWSDQSDLKLQMVGLAGP
FT                   TDDAVLRGDPASRRFSVFRFRDGVLTAIESVNRPADHMLGRRLLAGTPTITPEQAADES
FT                   FELKSLLGK"
     atgagcaggc aggaaggcat cgtcatcgtc ggcgccggac agggcggctt ccaggcggcg        60
     gcctcgttgc gcgaggcggg cttcacgggc ccggtgacgc tggtcggtga ggaaccgggc       120
     ctgccctatc agcgcccgcc gctctccaag gcctatatga agggtgatgc cggcatcgag       180
     cagatcgagc tgcgtcccgc cgccttcttc gccgaccacg atatccagat agtcaacgcc       240
     cgcgccgagg ccatcgaccg cgcggcgcag cgggtcgtgc tggaaggcgg ggaagccctg       300
     ccctacgcgc acatgatcct cgccaccggc gcccgcaacc ggccgctgcc agtgccgggg       360
     cgcgaattgg cgggcgtgta ctatctgcgc agccacgccg atgcggatgc gctcagagaa       420
     cggctcgaag gtgcgcgccg cgtggtggtg atcggcgccg gcttcatcgg gctggaattc       480
     gccgccgtcg cccgcacgct cggccatgag gtgacggtga tcgaggcggc cgcccgtccc       540
     ctcgcccgcg cggtctcgcc ggaaatgtcg gccttcttcg cggacgccca tacgagcatg       600
     ggcacgagcc tgttgctcgg cgccggcgtg attggactca tcggcgccgc cggccatgtg       660
     accggcgtcg agacgacgga cggcatggtg cacccggccg atttcgtcgt cgtcggcatc       720
     ggcgtgaccc ccaatgtcga gctcgccgcc gaagccgggc tggaagtggc caacggcatc       780
     gtggtcgacg cgcatctctc caccatggac cccgccatct cggccatcgg cgacgcggtg       840
     gcctatccga gccgctttgc cgatggactg gtgcggctgg aatcggtgca gaacgcggtg       900
     gaccaggcca aggccgtcgc cgcccggctc accggcaggc cggcgcccta tgcggcggtg       960
     ccgtggttct ggagcgacca gtccgacctg aagcttcaga tggtcggcct cgccggcccg      1020
     accgacgacg ccgtgctgcg cggcgacccg gcttcccgcc gcttctcggt gttccgcttc      1080
     cgggatggcg tgctgacggc aatagagagc gtcaaccgcc ccgccgacca catgctcggc      1140
     cggcgcctgc tcgccggcac gccgacgatc actcccgagc aggcggcgga cgagagcttc      1200
     gagctaaaga gcctgctggg gaaatga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page