(data stored in ACNUC1104 zone)

EMBL: CP002026.PE474

CP002026.PE474       Location/Qualifiers
FT   CDS_pept        complement(497217..497939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0478"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: pzu:PHZ_p0194 1-acylglycerol-3-phosphate
FT                   O-acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87811"
FT                   /db_xref="GOA:D7A393"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D7A393"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADH87811.1"
FT                   /translation="MSRLRSSAFLVLLVLWTVLLAPTIPYYALRNAPRATRRFSRIWAG
FT                   GVLAILRIVGVSCRTIGEANRPDGPALYVANHQSTFETIASAVLVPDVAIILKEELYKI
FT                   PVFGWFLRKSPMIAIDRAGGGTAMKKMFREGREAAAEGRSLLIFPEGTRQPVDVRAPMQ
FT                   RGVVLLYKALGLPVVPMVHNAGLFWLARSFEIRPGEITVSFLPPIPAGLPEAEFMERLS
FT                   AAIYDERDRLVAQAQEAA"
     atgtcccgcc tgcgctcgtc cgccttcctc gtgctgctgg tcctgtggac ggtgctgctg        60
     gcgccgacca tcccctatta cgccctgcgc aacgcgccga gggcgacgcg gcgcttctcg       120
     cggatctggg ccggcggcgt gctggcgata ttgcgcattg tcggcgtctc ctgccgcacc       180
     atcggcgagg ccaaccggcc ggacgggccg gcgctctatg tcgccaacca ccagtcgacc       240
     ttcgagacca tcgccagcgc ggtgctggtg ccggacgtcg ccatcatcct caaggaagag       300
     ctctacaaaa tcccggtctt cggctggttc ctcaggaaat ccccgatgat cgccatcgac       360
     cgcgccggcg gcggcacggc gatgaagaag atgttccgcg agggccgcga ggccgcagcc       420
     gaaggccgca gcctgctgat cttcccggaa ggcacccgcc agccggtgga tgtgcgcgcg       480
     ccgatgcagc gcggcgtggt gctgctctac aaggcgctcg ggcttcccgt ggtaccgatg       540
     gtgcacaatg ccggcctgtt ctggctggcg cgcagcttcg agatcaggcc cggcgagatc       600
     accgtctcct tcctgccgcc gatcccggcc ggcctgccgg aggccgagtt catggagcgg       660
     ctttccgcgg cgatctatga cgagcgcgac cggctggtcg cgcaggcgca ggaggccgca       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page