(data stored in ACNUC1104 zone)

EMBL: CP002026.PE476

CP002026.PE476       Location/Qualifiers
FT   CDS_pept        complement(499873..500832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0480"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: oan:Oant_1146
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87813"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z3"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADH87813.1"
FT                   /translation="MELRRLGRSDILVPPLCFGGNVFGWTADETTSFRLLDGLVEAGFS
FT                   FIDTADVYSRWADGHAGGESETIIGNWMKARGNRAKIVLATKVGGDMGLGKRCLKPDYI
FT                   RSAVEASLKRLQTDYIDLYQSHWDDPETPFEDVLDIYEELIKAGKVRLIGASNLSPARL
FT                   FEALAVATREKLPRYETFQPEYNLYDRAGYENELEPICSGNGLGVITYFSLAAGFLTGK
FT                   YRSAADAQKSVRGRAAVDKYLNDRGRRILAALDQVSAAHGVSPSQVALAWVMARPSVTS
FT                   AIASASKVEQLGDLLASAELRLTNSEISRLDAASAWKE"
     atggaactgc gccggctcgg acgctccgac atactggtcc cgccgctctg cttcggcggc        60
     aacgtgttcg gctggaccgc cgacgagacg acctccttcc gcctgctcga cggcctcgtc       120
     gaggcgggct tcagcttcat cgacaccgcc gacgtctatt cgcgctgggc ggacgggcat       180
     gccggcggcg aatccgagac tatcatcggc aactggatga aggctcgcgg caaccgcgcc       240
     aagatcgtcc tcgccaccaa ggtcggcggc gacatgggcc tcggcaagcg ctgcctgaag       300
     ccggactata ttcgcagcgc cgtcgaggcc tcgctgaagc gcctgcagac cgactatatc       360
     gacctctacc agtcgcattg ggacgatccc gagaccccgt tcgaggacgt gctggacatc       420
     tatgaggagc tgatcaaggc cggcaaggtg cgcctcatcg gcgcctccaa cctttctccc       480
     gcccggctgt tcgaggcgct ggcggtggcg acgcgcgaga agctgccgcg ctacgagacc       540
     ttccagcccg aatacaacct ctatgaccgc gccggctacg agaacgagct ggagccgatc       600
     tgctccggca acgggctcgg cgtcatcacc tatttctcgc tcgccgccgg cttcctcacc       660
     ggcaagtacc gctcggccgc cgacgcgcag aagagcgtgc gcgggcgcgc ggcggtcgac       720
     aaatatctca acgaccgcgg ccggcgcatc cttgcggccc tcgaccaggt gtccgccgcc       780
     catggcgtga gcccgtcgca ggtggcgctc gcctgggtga tggcgcgccc cagcgtcacc       840
     tccgccatcg ccagcgcctc gaaggtcgag cagctcggcg acctcctcgc ctcggccgag       900
     ctcaggctca ccaatagcga gatatcccgg ctcgacgccg ccagcgcctg gaaggaatga       960
//

If you have problems or comments...

PBIL Back to PBIL home page