(data stored in ACNUC1104 zone)

EMBL: CP002026.PE477

CP002026.PE477       Location/Qualifiers
FT   CDS_pept        complement(500932..501714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0481"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: mno:Mnod_3729 transcriptional regulator, DeoR
FT                   family; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87814"
FT                   /db_xref="GOA:D7A3Z4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z4"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADH87814.1"
FT                   /translation="MNISSRQQDILVLARAQGRVSVEDLAGRFEVSPQTIRKDLNDLCV
FT                   RRLMSRVHGGAVVASGVENLAYEARRAMAQGAKRAIAEAAALMVPNRASLFINIGTTTE
FT                   EVARALADHEDLLVITNNLNVATLLYRHPKIELIMAGGPVRHADGAVIGSSAVDFIRQF
FT                   RVDYAVIGASAIEEDGTLLDFDYREVQVARAIIDNARQVILVADRSKLERSAPVRIGAM
FT                   SEVDTFVTDTVSSPELRHVCQREQVELIEVGSLDEDGF"
     atgaacatct cctcacgcca gcaggacatc ctcgtgctcg cccgtgcgca ggggcgcgtg        60
     agcgtcgagg acctcgccgg gcgcttcgag gtctcgccgc agaccatccg caaggacctc       120
     aacgacctgt gcgtgcgccg gctgatgtcg cgcgtgcatg gcggcgccgt ggtggcttcc       180
     ggcgtcgaga accttgccta tgaagcccgc cgcgccatgg cgcagggcgc caagcgcgcc       240
     atcgccgagg cggccgcgct catggtgccg aaccgcgcct cgctgttcat caacatcggc       300
     accaccaccg aggaggtcgc tcgcgcgctg gccgaccacg aggacctcct cgtcatcacc       360
     aacaatctca acgtcgccac cctgctctac cgccacccga agatcgagct gatcatggcc       420
     ggcggcccgg tgcggcatgc cgacggcgcg gtgatcggtt cctcggcggt cgacttcatc       480
     cgccagttcc gcgtcgacta tgccgtcatc ggcgcctcgg cgatcgagga ggacggcacg       540
     ctgctcgatt tcgactatcg cgaggtgcag gtcgcccgcg ccatcatcga caatgcccgc       600
     caggtcatcc tggtcgccga ccgctccaag ctggaacgct ccgcgccggt gcgcatcggc       660
     gccatgtccg aggtcgacac cttcgtcacc gacaccgtct cctcgccgga actgcgccat       720
     gtctgccagc gcgagcaggt ggagctcatc gaggtcggca gcctcgacga ggatggtttc       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page