(data stored in ACNUC1104 zone)

EMBL: CP002026.PE478

CP002026.PE478       Location/Qualifiers
FT   CDS_pept        complement(501826..502938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0482"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: rpc:RPC_1050 acetyl-CoA C-acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87815"
FT                   /db_xref="GOA:D7A3Z5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z5"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADH87815.1"
FT                   /translation="MSRAFIASARRTAVAPRRGAFNTVEAHDLAAPVLRACLDDAGVAP
FT                   DAVDHVILGNALSGGGNVARLAALAAGLPDGVPALTIDTQCCSGLDAIILAARLVEAGA
FT                   AEVVLAGGVESWSRAPLRARRPKAPDEKPAFYERPAFAPFPERDPDMIEAVAGLAREKG
FT                   ISRERQNGFAIHSHEKALAARERLKAEIVPVAGLDHDAFSRALTMKLCARAPVLAGDGE
FT                   TVIDATGAAVEADAAAAVLVVSERRAAAGGIATLDGLSVGGAPEQPAMALVPAVERLLA
FT                   RHQGTPAVVELMEAFAAQALANIDALGLDPAGINPGGGALARGHPIGASGAILAVRLFH
FT                   ELKARPEGTRGLAAIAAAGGLGAAMLLQRT"
     gtgagccgcg ccttcatcgc gagcgcccgc cgcacagccg tggcaccccg gcgcggggcg        60
     ttcaacacag tggaggcgca cgacctcgcc gcgccggtgc tgcgggcctg cctcgatgac       120
     gccggcgtcg cgccggacgc ggtcgatcac gtcatcctcg gcaatgcgct atccggcggc       180
     ggcaatgtcg cccgcctcgc cgcgctcgcc gccggtctgc cggacggcgt gccggcgctc       240
     acgatcgata cccagtgctg ctccggtctc gacgccatca tccttgctgc ccgcctcgtc       300
     gaggccggcg cggcggaggt cgtgctggca gggggcgtcg agagctggag ccgggcgccc       360
     ttgcgcgccc gtcgtccgaa ggcgccggac gagaagccgg ccttctatga gcgcccggcc       420
     ttcgcgccgt ttcccgagcg cgaccccgac atgatcgagg ccgttgccgg gctcgcccgc       480
     gaaaagggca tttcgcgcga gagacagaac ggcttcgcga tccacagcca cgaaaaggcc       540
     ctcgccgccc gcgagcggct gaaggcggag atcgtgccgg tcgccggcct cgaccacgac       600
     gccttcagcc gcgccctcac catgaagctc tgcgcccgcg cgccggtgct cgccggcgac       660
     ggcgaaaccg tcatcgacgc taccggagcc gccgtggagg ccgatgcggc cgcagcggtg       720
     ctggtcgtct cggagcgccg agcggccgcc ggcggcattg ccaccctcga cgggctctcc       780
     gtcggcggcg cgccggagca gccggcgatg gcgctggtgc ccgccgtcga acgtcttctt       840
     gcgcgccacc aaggcacgcc cgccgtcgtc gagctcatgg aagccttcgc cgcgcaggcg       900
     ctggcgaata tcgacgccct cggcctcgat cccgccggca tcaatcccgg cggcggggcg       960
     ctggcgcgcg gccatcccat cggcgcgtcg ggcgccatcc tcgccgtgcg gctgttccac      1020
     gaattgaagg cgcggccgga aggaacgcgc ggcctcgccg ccatcgccgc ggccggcggg      1080
     ctcggcgccg cgatgctgct gcagcgcacc taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page