(data stored in ACNUC1104 zone)

EMBL: CP002026.PE48

CP002026.PE48        Location/Qualifiers
FT   CDS_pept        complement(38689..39270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0048"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   atc:AGR_L_1375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87385"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX1"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ADH87385.1"
FT                   /translation="MTSKLATLTAAAALALAPAVAFSQSPAPESTTPPAASPMAPDAGT
FT                   PQAPASEMPNTNTPSATPTTPPSGDTAAAKPAPSTPKFVSTQSSGQWLGSDLIGTAVVT
FT                   STDEKLGSISDLVLERDGSVIAAVIDVGGFLGIGAKPVAVSFDSLTPTPTDDGQKIVVA
FT                   LTKEELNSAPEFKSLEQMRSETSDAGAKTN"
     atgaccagca agcttgcgac cctgaccgcc gccgctgcct tggcgctcgc cccggcggtc        60
     gcattcagcc agagcccggc gccggaatcc accactccgc ccgccgccag cccgatggcg       120
     ccggatgccg gcaccccgca ggctccggct tccgagatgc cgaacaccaa taccccgagc       180
     gcgaccccga ccactccgcc ttcgggcgac acggccgcgg ccaagcccgc cccctcgacg       240
     ccgaaattcg tgagcaccca gagctcgggc cagtggctcg gctccgacct gatcggcacc       300
     gccgtcgtga cctcgaccga cgagaagctc ggctcgatca gcgatctggt gctggagcgc       360
     gacggcagcg tcatcgccgc ggtgatcgac gtcggcggct tcctcggcat cggcgccaag       420
     ccggtggcgg tgtccttcga ctcgctcacc ccgacgccga ccgacgacgg ccagaagatc       480
     gtggtcgccc tcaccaagga ggaactgaac tcggcgccgg aattcaagtc gctggagcag       540
     atgcgcagcg agacctcgga cgccggcgcc aagaccaact aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page