(data stored in ACNUC1104 zone)

EMBL: CP002026.PE483

CP002026.PE483       Location/Qualifiers
FT   CDS_pept        complement(506323..507156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0487"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: azc:AZC_2900
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87820"
FT                   /db_xref="GOA:D7A400"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7A400"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADH87820.1"
FT                   /translation="MSRVVLPGGTRVPALGIGTWMMGERPAARKEETESVRLGVELGLT
FT                   LVDTAEMYGEGACETFLGEALAGLRDKVFLVSKVYPHNASRAGVVAACERSLKRLKTDH
FT                   LDLYLLHWRGGVPLAETIIGFEHLKSQGKIRHWGVSNFDTDDMNELYETPGGEGCAVNQ
FT                   VLYNLTRRGPEYDLLPWLEEQEIPLMAYSPIEQGRIKTSGVLAQIAAKHGAKPFQVALA
FT                   WVLRSPNNIVIPKASRPEHMRENAGARDIKLDNDDLAALDAAFPPPSRKRSLEML"
     atgagcagag tggttcttcc cggcgggacg cgggttcccg ctctcggcat cggtacatgg        60
     atgatgggcg agcgccccgc cgcgcggaag gaggagaccg aatcggtccg tctcggcgtc       120
     gagctcggcc tgacgctggt cgacaccgcc gagatgtatg gcgagggcgc ctgcgagacc       180
     ttcctcggcg aggcgctggc cgggctgcgc gacaaggtgt tcctcgtctc caaggtctat       240
     ccgcacaatg ccagccgcgc cggcgtcgtc gccgcctgcg agcgcagcct gaagcggctg       300
     aagaccgacc atctcgatct ttacctgctc cattggcgcg gcggcgtgcc gctggccgag       360
     accatcatcg gcttcgagca cctcaagagc cagggcaaga tccgccactg gggcgtgtcg       420
     aacttcgaca ccgacgacat gaacgagctc tacgagaccc ccggcggcga gggctgcgcg       480
     gtcaaccagg tgctctacaa cctcacgagg cgcgggccgg aatatgacct gctgccctgg       540
     ttggaggagc aggaaatccc gctcatggcc tacagcccga tcgagcaggg gcgcatcaag       600
     acgagcggcg tgctggcgca gatcgccgcc aagcacggcg cgaagccctt ccaggtcgcg       660
     ctcgcctggg tgctgcgcag cccgaacaac atcgtcatcc ccaaggcctc gcgccccgag       720
     cacatgcgcg agaatgccgg cgcgcgcgac atcaagctcg acaatgacga cctcgccgcg       780
     ctcgacgccg ccttcccgcc gccgagccgg aagcgctcgc tggagatgct gtga             834
//

If you have problems or comments...

PBIL Back to PBIL home page