(data stored in ACNUC1104 zone)

EMBL: CP002026.PE484

CP002026.PE484       Location/Qualifiers
FT   CDS_pept        507279..508274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87821"
FT                   /db_xref="GOA:D7A401"
FT                   /db_xref="InterPro:IPR011213"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A401"
FT                   /inference="similar to AA sequence:KEGG:M446_4592"
FT                   /protein_id="ADH87821.1"
FT                   /translation="MSATPLTRPTADADLPDAPEPGLAIGLSAVIVAVTGDDPKVLTIR
FT                   HGDGRDSLPSGPLERGHRTLEVGLRSWVERQTLQELGYVEQLYTFGDRDRGEDGGRALS
FT                   LAYLALVREARPAGDTEAAWQSWYRYFPWEDWRGGRPAVLDSLEHGLRAWAAGAASSRM
FT                   GEIRAERIALCFGGMGGNEAGWNEERVLERYELLYEAGLVAEALRERGSERAASGPSGV
FT                   EMREDHRRMLALAIARLRGKIKYRPVVFEVMPPSFTLGQLQRTVEALSGARLHKQNFRR
FT                   LVEQQRLVEETGETTAETGGRPARLVRFRREVLLERPAPGVRLPGGFGRR"
     atgtccgcga cgccgctcac ccgtccgacc gccgacgccg acctgcccga tgcgcccgag        60
     cccgggctcg ccatcggcct gtcggcggtg atcgtcgcgg tgaccggcga cgaccccaag       120
     gtgctgacca tccgccatgg cgacggccgg gattcgctgc cctccggccc gctggagcgc       180
     ggccaccgca cgctggaggt ggggctgcga agctgggtgg agcggcagac gctgcaggag       240
     ctcggctatg tcgagcagct ctacaccttc ggcgaccgcg accgcggcga ggacggcggt       300
     cgcgcgctct cgctggccta tctcgctctg gtgcgcgagg cgcgcccggc cggcgacacg       360
     gaggccgcct ggcagagctg gtaccgctat ttcccgtggg aggactggcg cggcggccgg       420
     ccggcggtgc tcgacagcct ggaacacggg ctgcgcgcct gggcggcggg ggcggcgagc       480
     tcgcgcatgg gcgagatccg cgccgagcgc atcgcgttgt gcttcggcgg catgggcggc       540
     aacgaggcgg gctggaacga ggagcgggtg ctggagcgct acgagctgct ctacgaggcc       600
     ggcctcgtcg ccgaggcgct gcgcgagcgc ggctccgagc gcgcggcgtc cggcccctcc       660
     ggcgtcgaga tgcgcgagga ccaccggcgc atgctggcgc tcgccatcgc ccgactgcgc       720
     ggcaagatca aataccgccc cgtggtgttc gaggtgatgc cgccgagctt cacgctcggc       780
     cagctccagc gcacggtgga ggcgctctcc ggcgcgcggc tgcacaagca gaatttccgc       840
     cggctggtgg agcagcagcg cctggtcgag gagaccggcg agaccaccgc cgagaccggc       900
     ggccggccgg ctcgcctcgt gcgcttccgc cgcgaggtgc tgctggagcg ccccgcgccg       960
     ggcgtgcgcc tgcccggcgg cttcgggcgg cggtga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page