(data stored in ACNUC1104 zone)

EMBL: CP002026.PE486

CP002026.PE486       Location/Qualifiers
FT   CDS_pept        508880..509950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0490"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="KEGG: mdi:METDI3401 putative quinolinate synthetase
FT                   A (NadA-like); TIGRFAM: quinolinate synthetase complex, A
FT                   subunit; PFAM: Quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87823"
FT                   /db_xref="GOA:D7A403"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D7A403"
FT                   /inference="protein motif:TFAM:TIGR00550"
FT                   /protein_id="ADH87823.1"
FT                   /translation="MLDLDVAARMGTTEDFAPDLAPANAPSSPSALPLAHLYERVSKHV
FT                   TPAEWPLIVRDVEAIERLKKQRNAVVLGHNYQAPEIFNTVADIVGDSLALAREAVTVDA
FT                   DVIVMAGVHFMAETAKLLNPSKIVLMPDMEAGCSLAESITAEDIRLLRQRYPGVPVVTY
FT                   VNTSAEVKAESDYCCTSGNAVKVVRAVAKEWGVNRILMLPDEYLARNVQKEVPEIELIA
FT                   WKGHCEVHERFTPQDIRDLRENHPGVVVLAHPECPPEVVAAADYAGSTAGMADYVRDEK
FT                   PARVVLITECSMADNVAVNHPDVEFVRPCNLCPHMRRITLPNIRRALETMGHQVEIDPA
FT                   VADRARLAVERMLAIR"
     atgctggatc tcgacgtcgc cgcccgcatg ggaaccactg aggatttcgc ccccgacctg        60
     gcgcccgcca acgcgccttc cagtcccagt gccttgccgc tggcgcatct ctatgagcgc       120
     gtgtcgaagc acgtcacccc ggccgaatgg ccgctgatcg tgcgcgacgt cgaggcgatc       180
     gagaggctga agaagcagcg caatgccgtg gtgctcggcc acaactacca ggcgccggaa       240
     atcttcaaca cggtggccga catcgtcggc gatagcctcg cgctcgcccg cgaggctgtg       300
     acggtcgatg ccgacgtcat cgtcatggcc ggtgtgcatt tcatggccga gacggccaag       360
     ctgctgaacc cttccaagat cgtgctgatg ccggacatgg aagcgggctg ctcgctcgcc       420
     gagagcatca ctgcggagga tatccgcctg ctgcgccagc gttatccggg cgtgccggtg       480
     gtcacctatg tcaacacctc ggccgaggtg aaggccgaga gcgactattg ctgcacctcc       540
     ggcaatgccg tgaaggtggt gcgcgccgtg gcgaaggaat ggggcgtcaa ccgcatcctc       600
     atgctgccgg acgagtacct cgcccgcaac gtgcagaagg aagtgccgga gatcgagctt       660
     atcgcctgga agggccattg cgaggtgcat gagcgcttca ccccgcagga cattcgcgac       720
     ctgcgcgaga accatcccgg cgtcgtggtg ctggcgcacc ccgaatgccc gccggaggtg       780
     gtggcggcgg ccgactatgc gggctccacg gccggcatgg ccgactatgt gcgcgacgag       840
     aaaccggcgc gggtggtgct gatcactgaa tgctccatgg ccgacaatgt cgcggtgaac       900
     catcccgacg tcgagttcgt gcggccctgc aatctgtgcc cgcatatgcg ccggatcact       960
     ctgccgaaca tccgccgggc gctggagacc atgggccacc aggtcgagat cgacccggcc      1020
     gtggccgacc gcgcgcgcct tgccgtcgag cgcatgctcg ccatccgctg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page