(data stored in ACNUC1104 zone)

EMBL: CP002026.PE488

CP002026.PE488       Location/Qualifiers
FT   CDS_pept        511493..512350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0492"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   KEGG: mex:Mext_2646 nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87825"
FT                   /db_xref="GOA:D7A405"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D7A405"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ADH87825.1"
FT                   /translation="MTLPPLPRLLVEPVVRAALLEDLGRAGDVTTDSVIPVEARFDAVI
FT                   ASRQTGVIAGIDAAVIAFELIDPSLSIVVERRDGTSVGPGDVVMRLNGSARAILTAERV
FT                   ALNIACRMSGVATATAGLVEIARQHGKAHIVCTRKTTPGLRALEKHAVKAGGGSNHRFG
FT                   LDDAVLIKDNHIAVAGGVAPAIRAAKANAGHMVKIEVEVDTLNQLEEAMAEGVDAVLLD
FT                   NMTPPVLKEAVSIVGGRALTEASGRVSRETVGPIAASGVDLISVGWITHSAPILDLGLD
FT                   AASV"
     atgaccctcc cccctcttcc ccgcctgctg gtcgagccgg tcgtgcgcgc cgcgctgctg        60
     gaggaccttg gccgcgccgg cgacgtgacg accgattccg tcatccccgt ggaagcccgc       120
     ttcgacgcgg tgatcgcctc gcgccagacc ggcgtcatcg ccggcatcga cgcggcggtg       180
     atcgccttcg agctgatcga tccgagtctt agcatcgtcg tcgagcgccg cgacgggacg       240
     agcgtcgggc cgggcgacgt ggtgatgcgg cttaacggtt cggcgcgtgc catcctcacc       300
     gccgagcggg tggcgctcaa catcgcctgc cgcatgtcgg gggtggccac cgccaccgcc       360
     ggcctggtcg agatcgcccg ccagcacggc aaggcgcaca tcgtctgcac ccgcaagacc       420
     acgccgggcc tgcgcgcgct ggagaagcac gcggtgaagg cgggcggtgg ctccaaccac       480
     cgcttcggcc tcgacgacgc ggtgctgatc aaggacaacc acatcgcggt cgccggcggc       540
     gtcgcgccgg ccatccgcgc cgccaaggcc aatgccggcc acatggtgaa gatcgaggtc       600
     gaggtcgaca ccctcaacca gctcgaggaa gcgatggcgg agggcgtcga cgcggtgctg       660
     ctcgacaaca tgacgccgcc ggtgctgaag gaggcggtga gcatcgtcgg cgggcgggcg       720
     ctgacggaag cttccggccg cgtctcgcgc gagacggtcg ggccgatcgc ggcgagcggg       780
     gtggacctga tctcggtcgg ctggatcacc cattccgcgc cgatcctcga tctggggctg       840
     gacgcggcga gcgtgtga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page