(data stored in ACNUC1104 zone)

EMBL: CP002026.PE489

CP002026.PE489       Location/Qualifiers
FT   CDS_pept        complement(512365..512709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SORBIDRAFT_01g002330; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87826"
FT                   /db_xref="UniProtKB/TrEMBL:D7A406"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87826.1"
FT                   /translation="MSIDMEQLQRDILTAASGAAATDIGNLAGFSRSQLRKIAKQTEWI
FT                   RAGRLAGDLDDELFRFHLDDLARLIDSFVRVLAALTIVMMERVWNAIVGVVWRTMETAI
FT                   GAPIPLPFRP"
     atgtcgatcg atatggagca gttgcagcgg gacatcctga cggccgcatc cggcgccgcg        60
     gcgaccgaca tcggcaacct tgccggcttt tcccgcagcc agctcaggaa gatcgcgaag       120
     cagactgaat ggatccgcgc cggccgcctc gccggcgatc tcgacgacga gctgtttcgc       180
     tttcacctcg acgatctcgc gcgcctcatc gacagcttcg tcagggtgct ggcggcgctg       240
     accatcgtca tgatggagag ggtctggaac gccatcgtcg gcgtcgtctg gcgaacgatg       300
     gaaacggcga tcggcgcgcc catccccctg cccttccggc cctag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page