(data stored in ACNUC1104 zone)

EMBL: CP002026.PE49

CP002026.PE49        Location/Qualifiers
FT   CDS_pept        complement(39424..39855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GI18025 gene product from transcript
FT                   GI18025-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87386"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX2"
FT                   /inference="similar to AA sequence:KEGG:Dmoj_GI18025"
FT                   /protein_id="ADH87386.1"
FT                   /translation="MAGVVSTAFKGSAYLLGAVTGAALMVPVTAGALSAGAIARITPHP
FT                   VAIEMMGPPANLRAPVVNRAAKGPRLDSGPAGTPAAVAPAGAATRPVVDSATPAPASPP
FT                   RVMRTPKGCLSAMGVTKSNLATEELTVCVADASIVNSLN"
     atggctggcg tcgtcagcac ggctttcaag ggttccgcct atctgctcgg cgccgttacc        60
     ggcgcggcgc tcatggtgcc ggtcacggcc ggcgcactca gcgccggcgc tatcgcccgc       120
     atcaccccgc accccgtcgc catcgagatg atgggtccgc ccgcaaacct gcgcgcgccg       180
     gtggtcaacc gcgccgccaa gggcccgcgg ctggacagcg gcccggccgg cacgcccgct       240
     gccgtcgccc cggccggcgc ggcaacccgt ccggtcgtgg acagcgcgac gccggcaccg       300
     gcgagcccgc cgcgggtgat gcgcacgccc aaggggtgcc tttcggccat gggtgtgacg       360
     aaatccaacc tcgcgacgga agaacttacc gtctgcgtgg ccgatgcctc gatcgtcaac       420
     agcctgaact ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page