(data stored in ACNUC1104 zone)

EMBL: CP002026.PE490

CP002026.PE490       Location/Qualifiers
FT   CDS_pept        complement(512723..513229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GI18025 gene product from transcript
FT                   GI18025-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87827"
FT                   /db_xref="GOA:D7A407"
FT                   /db_xref="UniProtKB/TrEMBL:D7A407"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87827.1"
FT                   /translation="MTTARVKVPPALPLASSLWRVMAFIIVFAVTAGCALRLAPQYDPS
FT                   IVRGIESANEQAMVLFATVAPGVKASTFPTRAPAYAQVIGQLDALRLLAESRPAPPPSS
FT                   FGPSAGQVVDPPTPSILTNVSALIAQMRDRDARHGLTAAQVPGFRQSYETWMEQAITYE
FT                   TALRR"
     atgaccaccg ccagggtaaa agtaccgccg gcattgccgc ttgcctcgtc gctgtggcgc        60
     gtcatggcgt tcatcatcgt cttcgccgta acggcgggat gcgcgctccg gctggcgccg       120
     caatacgatc cctcgatcgt gagggggatc gaaagcgcga acgaacaggc catggtgctg       180
     ttcgcgaccg tcgcgccggg cgtcaaggcg tccacctttc ccacccgcgc cccggcctat       240
     gcccaggtga tcggccagct cgacgcgctg cggctgctcg ccgaatcgcg gccggcgcct       300
     ccgccttctt ccttcggacc gtccgcgggg caggtggtcg atccgcccac gccctccatc       360
     ctcaccaacg tatccgccct catcgcgcag atgcgcgaca gggatgcccg gcacgggctg       420
     acggccgcgc aggtacccgg tttccgccag agctacgaga cgtggatgga gcaggccatc       480
     acctacgaga ccgcgttgcg gcgatag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page