(data stored in ACNUC1104 zone)

EMBL: CP002026.PE493

CP002026.PE493       Location/Qualifiers
FT   CDS_pept        516229..517392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0497"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rlg:Rleg_3723 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87830"
FT                   /db_xref="GOA:D7A410"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7A410"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH87830.1"
FT                   /translation="MPRIARYLPALAACASLSLQPALAAEMTSLGKGEGQVDIVAWAGY
FT                   IERGDTDKAYDWVTDFEKKTGCKVNVKTAGTSDEMVALMNEGGFDLVTASGDASLRLIA
FT                   GKKVAPVNTKLIPSWGTVDERLQNAPWHTVDGVHYGVPYQWGSNVLMYNTEAFKGEAPK
FT                   SWNVVFEEQTLPDGKSNKGRVQAFDGPIYIADAALYLMAHKPELGIKDPYELTEEQYKA
FT                   ALDLLRQQRKIVQRYWHDAMIQIDDFTNEGVVASSSWPFQVNLLQSQKKPIASTIPSEG
FT                   ATGWADTTMLHADAAHPNCAYMWMEHSLSPKVQGDLASWFGSVPAVPAACKGNELLGAE
FT                   GCKTNGIEDFEKIHFWRTPVAKCPTQAAGCVPYYRWVSDYIAVLGGR"
     atgccgcgca tcgcccgtta tctgccggcg cttgccgcct gcgcctcgct cagcctgcag        60
     cccgcgctcg ccgccgagat gacctcgctc ggcaagggcg agggccaggt cgatatcgtc       120
     gcctgggccg gctacatcga gcgcggcgac accgacaagg cctatgactg ggtcaccgat       180
     ttcgagaaga agaccggctg caaggtcaat gtgaagaccg ccggcacctc ggacgagatg       240
     gtggcgctga tgaacgaggg cggcttcgac cttgtcaccg cctccggcga cgcctcgctg       300
     cgcctcatcg ccggcaagaa ggtcgccccc gtcaacacca agctgatccc gagctggggc       360
     accgtcgacg agcggctgca gaacgcgccc tggcacacgg tggacggggt gcattacggc       420
     gtgccctacc agtggggctc caacgtgctg atgtacaaca ccgaggcctt caagggcgaa       480
     gcgccgaaga gctggaacgt cgtgttcgag gagcagacgc tgcccgacgg caagtccaac       540
     aagggccgcg tgcaggcctt cgacgggccg atctacattg ccgacgccgc gctctatctg       600
     atggcgcaca agccggagct cggcatcaag gacccctacg agctgaccga ggagcagtac       660
     aaggcggcgc tcgacctgct gcgccagcag cgcaagatcg tgcagcgcta ctggcacgac       720
     gcgatgatcc agatcgacga cttcaccaat gagggcgtcg tcgcctcctc ctcctggccg       780
     ttccaggtga acctgctgca gagccagaag aagccgatcg cctcgaccat cccctccgag       840
     ggggccaccg gctgggccga caccaccatg ctgcatgccg acgcggcgca tcccaactgc       900
     gcctatatgt ggatggagca ctcgctcagc ccgaaggtgc agggcgacct cgcctcctgg       960
     ttcggctcgg tgccggccgt gcccgccgct tgcaagggca acgagctgct cggcgccgag      1020
     ggctgcaaga ccaacggcat cgaggatttc gagaagatcc atttctggcg cacgccggtc      1080
     gccaagtgcc cgacgcaggc agccggatgc gtgccttact accgctgggt gtccgactac      1140
     atcgccgtgc tcggcgggcg atag                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page