(data stored in ACNUC1104 zone)

EMBL: CP002026.PE494

CP002026.PE494       Location/Qualifiers
FT   CDS_pept        517565..517924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ape:APE_2384 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87831"
FT                   /db_xref="GOA:D7A411"
FT                   /db_xref="UniProtKB/TrEMBL:D7A411"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87831.1"
FT                   /translation="MTRRMTAYTATTKGILIGVIAFTAGGAIVAGVVSVWDRAAIALED
FT                   PALQVCEQGEDHAPHPRGGYAFAATHMARMPHGVGTVWQPRLSTADLLPTPSLGERAAH
FT                   AFRTVFSCTPRSTPS"
     atgacacgtc gcatgaccgc ctacaccgcc acgaccaagg ggatactgat cggcgtcatc        60
     gccttcaccg ccggcggcgc catcgtggct ggggtcgtct cagtgtggga ccgcgccgcc       120
     atcgccctgg aggacccggc cttgcaggtg tgcgagcagg gcgaggacca cgctccgcat       180
     ccgcgcggcg gctacgcctt cgccgcgacc cacatggcgc ggatgccgca cggcgtcggc       240
     accgtctggc agccgcgcct ttccaccgcc gacctcttgc ctacgccgag cctcggcgaa       300
     agagccgctc acgccttccg gaccgtcttt tcatgcacgc cacgctcgac accgtcctga       360
//

If you have problems or comments...

PBIL Back to PBIL home page