(data stored in ACNUC1104 zone)

EMBL: CP002026.PE495

CP002026.PE495       Location/Qualifiers
FT   CDS_pept        517897..518940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0499"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: rec:RHECIAT_CH0003932 probable
FT                   spermidine/putrescine ABC transporter, ATP-binding protein;
FT                   PFAM: ABC transporter related; Transport-associated OB
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87832"
FT                   /db_xref="GOA:D7A412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A412"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87832.1"
FT                   /translation="MHATLDTVLTTPAVRFQGVMRHFGTVKAVDGVDLAIQPGEFFAML
FT                   GPSGSGKTTCLRLIAGFEQPDAGHIDIFGETVEGLPPYRRAVNTVFQDYALFPHLSVGE
FT                   NVAYGLRVRGVGRAERDKLAREALAMVKLAGMEGRRPVQLSGGQRQRVALARALVVRPK
FT                   VLLLDEPLGALDLKLREEMQVELKNLQRALGLTFVFVTHDQSEALSMADRVAVFNEGRI
FT                   VQVGPPEEVYERPATRFVAGFVGSANVLGAAQAAALGAAERPCSLRPEKIALLGPGDPV
FT                   PEGAALVEADVLDVSYQGPVRRVAARCASGLTLTAAVPASGPRVAPGEGVRLAIPRAAI
FT                   EPMEGEG"
     atgcacgcca cgctcgacac cgtcctgacc acccccgccg tccgcttcca gggcgtgatg        60
     cggcatttcg ggacggtgaa agcggttgac ggcgtcgacc tcgccatcca gcccggcgag       120
     ttcttcgcca tgctcggccc gtccggctcc ggcaagacca cctgcctgcg gctcatcgcc       180
     ggcttcgagc agcccgatgc cggccatatc gatatcttcg gcgagacggt ggagggcctg       240
     ccgccctatc ggcgggcggt gaacaccgtg ttccaggact acgcgctgtt cccccacctc       300
     tcggtcggcg agaacgtcgc ctatgggctg cgggtgcgtg gcgtcgggcg ggcggagcgg       360
     gacaagctgg cgcgcgaggc gcttgccatg gtcaagctcg ccggcatgga gggccgccgc       420
     ccggtgcagc tctccggcgg ccagcgccag cgcgtcgcgc tcgcccgcgc gctggtggtg       480
     cggcccaagg tgctcctcct cgacgagccg ctcggcgcgc tcgacctcaa gctgcgcgag       540
     gagatgcagg tcgagctgaa gaacctgcag cgcgcgctcg gcctcacctt cgtcttcgtc       600
     acccacgacc agagcgaggc gctctccatg gccgaccggg tggcggtgtt caacgagggc       660
     cgcatcgtcc aggtcggccc gccggaagag gtctatgagc gcccggcgac ccgcttcgtc       720
     gccggcttcg tcggctcggc caatgtgctc ggcgcggcgc aggcggcagc gctgggcgcg       780
     gccgagcggc cctgcagcct gcggccggag aagatcgcgc tgctgggccc gggcgatccg       840
     gtgccggagg gcgccgcgct cgtcgaggcg gacgtgctcg acgtctccta tcaggggccg       900
     gtgcgccgcg tcgccgcgcg ctgcgcctcc gggctgacgc tcaccgccgc cgtgccggca       960
     agcggcccgc gcgtcgcgcc gggggagggc gtgcggctcg ccataccccg cgcggccatc      1020
     gagccgatgg agggcgaggg atga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page