(data stored in ACNUC1104 zone)

EMBL: CP002026.PE496

CP002026.PE496       Location/Qualifiers
FT   CDS_pept        518937..519884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0500"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mlr5383 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87833"
FT                   /db_xref="GOA:D7A413"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A413"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87833.1"
FT                   /translation="MSLAVLDLPAPPEGLRRRLSDFLVRRARLLTLLLLVPPLLWIGLV
FT                   YLGSLFVFLGQAVFSIDEFSGTIVREPTTATLLELFRPANFDIVMRTVFVAAAVTALCA
FT                   IIAFPIAYYAARYAGPRTKAGFYLAVMMPLWSSYLVKVYGWKLLLAREGAIGWFAGKLG
FT                   LAGALQAWLDLPVVGGPSLSVSYTGMVLTFTYLWLPFMILPVQAALERVPPHLIEAAGD
FT                   LGASPRMVLRTVILPLAMPGVVAGAIFTFSLTLGDYIVPQIIGTSALVLGQAVYTLQGT
FT                   AGNIPLAAAFSLVPILVMALFLTLAKRTGAFDAL"
     atgagcctcg cggtactcga tcttcccgcg ccgcccgagg ggctgcggcg gcgcctctcg        60
     gacttcctgg tgcggcgggc gcggctgctg acgctgctct tgctcgtgcc gccgctcctg       120
     tggatcggcc tcgtctatct cggcagcctg ttcgtcttcc tcggccaggc ggtcttctcc       180
     atcgatgagt tctccggcac catcgtgcgc gagccgacca cggcgacgct gctggagctg       240
     ttccgcccgg ccaatttcga catcgtcatg cgcaccgtct tcgtggcggc ggcggtgacc       300
     gcgctgtgcg ccatcatcgc cttccccatc gcctattacg ccgcccgcta tgccgggccg       360
     cggacgaagg cgggcttcta cctcgcggtg atgatgccgc tatggtcgag ctacctcgtc       420
     aaggtctatg gctggaagct gctgctcgcc cgcgaaggcg ccatcggctg gttcgccggg       480
     aagctcggcc tcgccggcgc gctgcaggcg tggctcgacc tgccggtggt gggcggaccg       540
     tcgctctcgg tcagctatac cggcatggtg ctgaccttca cctatctctg gctgcccttc       600
     atgatcctgc ccgtgcaggc ggcgctggag cgggtgccgc cgcatctcat cgaggccgcc       660
     ggggatctgg gcgcctcgcc gcgcatggtg ctgcgcacgg tgatcctgcc gcttgccatg       720
     cccggcgtgg tggcgggggc gatcttcacc ttctcgctga cgctcggcga ctacatcgtg       780
     ccgcagatca tcggcacctc ggccttggtg ctcgggcagg cggtctacac gctgcagggc       840
     acggcgggga acatcccgct ggcggccgcc ttctcgctgg tgccgatcct ggtcatggcc       900
     ctgttcctga cgctcgccaa gaggacggga gcgttcgatg cgctgtga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page