(data stored in ACNUC1104 zone)

EMBL: CP002026.PE498

CP002026.PE498       Location/Qualifiers
FT   CDS_pept        520837..522276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0502"
FT                   /product="Aminobutyraldehyde dehydrogenase"
FT                   /EC_number="1.2.1.19"
FT                   /note="KEGG: ara:Arad_3974 betaine-aldehyde dehydrogenase
FT                   protein; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87835"
FT                   /db_xref="GOA:D7A415"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D7A415"
FT                   /inference="protein motif:PRIAM:1.2.1.19"
FT                   /protein_id="ADH87835.1"
FT                   /translation="MTALSDTDMLIGSEFVAGTETPETVLNPKTEETLIELPEASPDQI
FT                   DAAVSAADKAFRTWSRTTPAERSYLLLKLADRIEQEAEAFATLEALNCGKPRHAVLNDE
FT                   IPGVVDCFRFFAGAARTQHGMVAGEYMAGHTSMIRRDPIGVVASIAPWNYPLMMAAWKL
FT                   APALAGGNTVVIKPSEQTPLTLLKLAKVIADIFPEGVVNVVVGRGESVGNALIHHPRVA
FT                   MVSLTGDIATGKKVLTAAAKTVKRTHLELGGKAPVIVFDDADIDAVVEGVKIFGYYNAG
FT                   QDCTAACRIYAGEKVYEKLVADLASAVSGLKFGQADDAQNDIGPLISARQRARVASFVE
FT                   RASELNHIEIATGGKLASGKGFFYEPTVVAGALQSDEIVRREVFGPVVSVTRFEDVDEA
FT                   VAWANDSDYGLASSVWTRDIGKGMATASRLQYGCTWVNCHFMLVNEMPHGGLKQSGYGK
FT                   DLSAYALEDYTVVRHVMVKNG"
     atgaccgctc tttctgacac cgacatgctc atcggctcgg agttcgtcgc cggcaccgag        60
     acgccggaga cggtgctgaa cccgaagacc gaggagacgc tgatcgagct gccggaggcc       120
     tcgccggacc agatcgacgc ggcggtgtcg gccgcggaca aggcgttcag gacgtggtcg       180
     cgcaccaccc cggcggagcg ctcctatctc ctgctcaagc tcgccgaccg catcgagcag       240
     gaggcggaag ccttcgccac gctggaggcg ctgaattgcg gaaaaccccg ccacgcggtg       300
     ctgaacgacg agatccccgg cgtggtcgac tgcttccgct tcttcgccgg cgccgcgcgc       360
     acccagcacg gcatggtggc gggcgagtac atggccgggc atacctcgat gatccggcgc       420
     gacccgatcg gcgtcgtcgc ctccatcgcg ccgtggaact acccgctgat gatggcggcg       480
     tggaagctcg ccccggcgct cgccggcggc aatacggtgg tgatcaagcc ctccgagcag       540
     acgccgctga ccctgctgaa gctggccaag gtgatcgcgg acatcttccc cgagggcgtg       600
     gtcaatgtgg tggtcgggcg cggggaaagt gtcggcaacg cgctgatcca ccaccccagg       660
     gtggcgatgg tctcgctcac cggcgacatc gccaccggca agaaggtgct gaccgccgcg       720
     gcgaagacgg tgaagcgcac gcatctggag ctcggcggca aggcgccggt gatcgtgttc       780
     gacgacgccg acatcgatgc cgtggtcgag ggggtgaaga tcttcggcta ctataatgcc       840
     gggcaggact gcaccgccgc ctgccgcatc tatgccggcg agaaggtcta cgagaagctg       900
     gtcgccgacc tcgcctccgc cgtctcgggt ctgaagttcg gccaggcgga cgacgcgcag       960
     aacgacatcg gcccgctgat ctccgcccgc cagcgcgccc gcgtcgcctc cttcgtcgag      1020
     cgggcttccg agctcaacca catcgagatc gccaccggcg gcaagctggc gtcgggcaag      1080
     ggtttcttct acgagccgac ggtggtggcc ggcgccttgc agtccgacga gatcgtgcgc      1140
     cgcgaggtgt tcggccccgt cgtctcggtc acccgcttcg aagatgtcga cgaggcggtg      1200
     gcctgggcca acgacagcga ctacggcctc gcctcctcgg tgtggacgcg ggacatcggc      1260
     aagggcatgg cgaccgcttc gcgcctgcaa tatggctgca cctgggtgaa ctgccatttc      1320
     atgctggtca acgagatgcc gcatggcggg ctgaagcagt ccggctacgg caaggatctc      1380
     tccgcctatg cgctggagga ctacaccgtc gtgcgccacg tcatggtgaa gaacggctga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page