(data stored in ACNUC1104 zone)

EMBL: CP002026.PE499

CP002026.PE499       Location/Qualifiers
FT   CDS_pept        522474..523574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0503"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: bpt:Bpet0632 RND efflux membrane fusion
FT                   protein; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87836"
FT                   /db_xref="GOA:D7A416"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D7A416"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADH87836.1"
FT                   /translation="MRRSTGVLLTVAVLVGAGALAQQRGWIDVGALVGGRGEANAAAEP
FT                   KPAPHIPVEVAPARQVTVTTDISSIGSLQSDESVKVASEVAGRIQEIRFKEGEQVKAGD
FT                   VLVQLDAALVKASLDETEARLDLAEANFSRAQKLQASGSGTARALDEAQAELNTSRALL
FT                   HSQRVQIAKHTITAPFDGVVGLRSVSNGAYIDTGDELVNLEKIDTLKLDFKVPERHLAS
FT                   VSPGQTVMVSVDALPSRTFTGTIYAIDPMVDVNGRSLSVRARLDNAQMALRPGLFARVT
FT                   IKGRETRDAVFVPESAIVPRGQERLVWQVVDGKAREAKVQLGQRGNGEVEIKGVPAGAT
FT                   IVVAGQGRLQPDALVEVVTPPPAPQG"
     atgcgacgta gtaccggcgt gcttctgacg gtggctgtcc tcgtgggagc gggtgcgctc        60
     gcccagcaga gagggtggat cgacgtcgga gcgctggtcg gcggacgcgg cgaggccaac       120
     gccgccgccg agcccaagcc cgcgccgcac atcccggtcg aggtcgcgcc ggcgcgccag       180
     gtgacggtga cgaccgacat ctcttccatc ggctcgctgc agtcggacga atcggtgaag       240
     gtcgcctccg aggtcgccgg ccgcatccag gaaatccgct tcaaggaggg cgagcaggtc       300
     aaggccggcg acgtgctggt gcagctcgac gcggcattgg tgaaggcctc gctcgacgag       360
     accgaggcaa ggctcgacct cgccgaggcg aatttcagcc gcgcccagaa gctccaggcc       420
     tccggctccg gcaccgcccg cgcgctcgac gaggcgcagg ccgagctcaa cacctcgcgc       480
     gccttgctgc attcccagcg cgtgcagatc gccaagcaca ccatcaccgc cccgttcgac       540
     ggcgtggtcg gcctgcgctc ggtctccaac ggcgcctata tcgacaccgg cgacgaactg       600
     gtgaacctcg agaagatcga cacgctcaag ctcgacttca aggttcccga gcgccacctc       660
     gccagcgtct cgcccggcca gacggtgatg gtctcggtcg acgcgctgcc gagccgcacc       720
     ttcaccggca ccatctacgc catcgacccg atggtcgacg tcaacggccg ctcgctgagc       780
     gtgcgcgccc ggctcgacaa tgcccagatg gcgctgcggc cgggcctgtt cgcccgcgtg       840
     accatcaagg gccgcgagac gcgcgatgcc gtcttcgtgc ccgagagcgc catcgtgccg       900
     cgcgggcagg agcgcctcgt ctggcaggtc gtcgacggca aggccaggga agccaaggtc       960
     cagctcggcc agcgcggcaa tggcgaggtc gagatcaagg gcgtgcccgc cggcgccacc      1020
     atcgtggtgg ccggccaggg ccggttgcag cccgatgcac tcgtggaggt ggtcacgccg      1080
     ccgccggcgc ctcagggctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page