(data stored in ACNUC1104 zone)

EMBL: CP002026.PE500

CP002026.PE500       Location/Qualifiers
FT   CDS_pept        523584..526658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0504"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   pla:Plav_2000 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87837"
FT                   /db_xref="GOA:D7A417"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D7A417"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADH87837.1"
FT                   /translation="MGISELCIRRPVFATVLSLLMVLIGIVSFSRLTVREYPNIDEPVV
FT                   SVVTTYPGASASIVESQVTQVLEGSIAGIEGIDVLESTSRSESSRITVRFRLEIDPDVA
FT                   ASDVRDRVSRVRQRLPDEIDEPVISKVEADAQPVMFVVFRSDRMTPLELSDYIDRYIVD
FT                   RFKNITGVADVQIYGERRYAMRIWIDRERLAAYNLTVQDVEDALSAQNVEIPSGRIESV
FT                   DREFTVLSRTALANVEQFNNIVVKRADGAQVHMSDVARVELGAADERRASRFNGGAAII
FT                   VGLIKQAVANPLDVSAGVREVLPAVNESLPEGMSGAIGNDNAVFIDRSIKSVFHTIFEA
FT                   VLLVVLVIVVFLRSIRASIIPIVTIPISLITTFGIMYALGFSVNTLTLLAFVLAIGLVV
FT                   DDAIVVLENIFRHIEHGMKPIPAAIKGAREIGFAVIAMTMTLAAVYAPVAFAPGRTGRL
FT                   FLEFALTLAGAVIVSGFVALSLTPMMCSRLLKHEDKPGRVSAFIERRLRGMEEGYRRLL
FT                   GATLRVRPLILLVAFCVAGASAYFLSVLPSELSPVEDRGVVRVSGSGPEGSTLAYTARY
FT                   TNQVEGILEKEPEVNSVLIINGFPEVHRFLVIGRLKDWDERDRRQQEIVRKVTPELRRI
FT                   AGVNAYANNPPSLGASNNSRPIEFVIQTSGTYEQLDEYVDRFLDRIRDYPGLISVDSDL
FT                   KLNKPEISVAVDRAKAADLGIDIAVLGRTLESLLGGRQVTRFEVGGEQYDVYVQLDARD
FT                   RSSPATLDTIYLRAASGEMVQLSNLVSVRESVAPQELKRFNQLRSATISANLAPGFSQG
FT                   EALAHLDEVAREVLPQTVQTDVSGQSREFRAAGQSLVLVFLLALGFIYLVLSAQFESFR
FT                   DPVIIMLTVPLSMTGALAALYFSGGSLNVYSQIGLVTLVGLITKHGILIVEFANQQQES
FT                   GLDRRAAVIEAAVLRLRPILMTTGAMVLGAVPLAFAAGAGAESRAQIGWVIVGGMSLGT
FT                   LLTLFVVPTVYSLIGRIHHTAHAEIAPGLVHTPAE"
     atgggcatct ccgagctctg catccgccgt ccggtcttcg cgacggtgct cagcctcctg        60
     atggtgctga tcggcatcgt gtcgttcagc cgcctgacgg tgcgcgaata tcccaacatc       120
     gacgagccgg tggtctcggt cgtcaccacc tatcccggcg cctcggcgag catcgtcgag       180
     agccaggtga cgcaggtgct ggaaggctcc atcgccggca tcgaaggcat cgacgtgctg       240
     gaatcgacca gccgctcgga atccagccgc atcaccgtgc gcttccggct ggagatcgac       300
     ccggacgtcg ccgccagcga cgttcgcgac cgcgtcagtc gcgtgcgcca gcggctgccg       360
     gacgagatcg acgaacccgt gatctccaag gtcgaggccg acgcgcagcc ggtgatgttc       420
     gtcgtcttcc gctccgaccg catgacgccg cttgaactct cggactatat cgaccgctac       480
     atcgtcgacc gcttcaagaa catcaccggc gtcgccgacg tgcagatcta tggcgagcgg       540
     cgctacgcca tgcgcatctg gatcgatcgc gagcgcctcg ccgcctacaa cctcaccgtc       600
     caggacgtcg aggacgcgct gagcgcgcag aacgtcgaga ttccgtccgg ccgcatcgag       660
     agcgtggacc gcgagttcac tgtgctctcg cgcacggcgc tggccaatgt cgagcagttc       720
     aacaacatcg tggtcaagcg ggccgacggc gcgcaggtgc atatgagcga cgtcgcccgg       780
     gtcgagctcg gcgccgccga cgagcgccgg gcgagccgct tcaacggcgg cgcggcgatc       840
     atcgtcggcc tgatcaagca ggcggtcgcc aacccgctcg acgtctcggc cggcgtgcgc       900
     gaggtgctgc cggcggtcaa cgagagcctg ccggaaggca tgagcggcgc catcggcaac       960
     gacaacgccg tgttcatcga ccgctcgatc aagtcggtgt tccacaccat cttcgaggcg      1020
     gtgctgctgg tggtgctggt gatcgtcgtg ttcctgcgct cgatccgcgc ttcgatcatc      1080
     ccgatcgtca ccatcccgat ctcgctgatc accaccttcg gcatcatgta tgcgctcggc      1140
     ttcagcgtga acacgctgac gctgctcgcc ttcgtgctcg ccatcggcct cgtggtcgac      1200
     gacgccatcg tggtgctgga gaacatcttc cgccacatcg agcacggcat gaagccgatc      1260
     cccgccgcca tcaagggcgc gcgcgagatc ggcttcgcgg tcatcgccat gaccatgacg      1320
     ctggcggcgg tctatgcgcc cgtcgccttc gcaccgggcc gcaccgggcg gctcttcctc      1380
     gaattcgcgc tgacgctggc cggcgcggtc atcgtctccg gcttcgtcgc gctcagcctc      1440
     acgccgatga tgtgctcgcg cctgctcaag cacgaggaca agccggggcg ggtctccgcc      1500
     ttcatcgaac gccgtctgcg cgggatggag gaaggctatc gccgcctgct cggagcgacg      1560
     ctgcgggtgc gcccgcttat cctccttgtg gccttctgcg ttgccggggc cagcgcctac      1620
     ttcctgagcg tgctgccctc tgaactctcg ccggtggagg accgcggcgt ggtgcgcgta      1680
     agcggcagcg ggccggaggg ttcgaccctc gcctatacgg cgcgctacac caaccaggtg      1740
     gagggcatcc tcgagaagga gccggaggtc aacagcgtcc tcatcatcaa cggcttcccg      1800
     gaggtgcacc gcttcctcgt catcggccgg ctgaaggact gggacgaacg cgaccgccgc      1860
     cagcaggaga tcgtcaggaa ggtgacgccg gagctcaggc gcatcgccgg cgtgaacgcc      1920
     tacgccaaca acccgccctc gctcggcgcg tccaacaatt cgcgtcccat cgagttcgtc      1980
     atccagacct cgggcaccta tgagcagctc gacgaatatg tcgaccgctt cctcgaccgc      2040
     atccgcgact atcccggcct gatcagcgtc gacagcgacc tgaagctcaa caagccggag      2100
     atctcggtgg cggtcgaccg cgccaaggcg gccgatctcg gcatcgacat cgccgtgctc      2160
     gggcgcacgc tggagagcct gctcggcggg cggcaggtca cgcgcttcga ggtgggcggc      2220
     gagcagtacg acgtctatgt ccagctcgac gcccgcgacc gttcctcgcc ggcgacgctc      2280
     gacaccatct atctgcgcgc ggcgagcggg gagatggtgc agctctccaa cctcgtctct      2340
     gtgcgcgaga gcgtggcgcc gcaggagctc aagcgcttca accagctgcg ctcggccacc      2400
     atctcggcca acctcgcgcc cggcttctcg cagggcgagg cgctcgccca tctcgacgag      2460
     gtggcgcgcg aggtgctgcc gcagaccgtg cagaccgacg tctccggcca gagccgcgag      2520
     ttccgcgccg ccggccagag cctggtgctg gtgttcctgc ttgcgctcgg cttcatctat      2580
     ctggtgctct cggcgcagtt cgagagcttc cgcgatcccg tcatcatcat gctgaccgtg      2640
     ccgctgtcga tgaccggcgc gctggcggcc ttgtacttct ccggcgggtc gctgaacgtc      2700
     tattcgcaga tcggtctggt gacgctggtg ggcctcatca ccaagcacgg catcctcatc      2760
     gtcgagttcg ccaaccagca acaggaatcc gggctcgacc gccgcgccgc ggtgatcgag      2820
     gcggcggtgc tgcgcctgcg cccgatcctg atgaccacgg gcgccatggt gctgggtgcg      2880
     gtgccgctgg cgttcgccgc cggtgccggc gcggagagcc gcgcgcagat cggctgggtc      2940
     atcgtcggcg gcatgagcct cggcactttg ctgacgctgt tcgtggtgcc gaccgtctat      3000
     tcgctgatcg gccgaatcca ccacaccgcc cacgccgaga tcgcgcccgg cctggtccat      3060
     accccggccg agtga                                                       3075
//

If you have problems or comments...

PBIL Back to PBIL home page