(data stored in ACNUC1104 zone)

EMBL: CP002026.PE502

CP002026.PE502       Location/Qualifiers
FT   CDS_pept        528440..529549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0506"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: met:M446_1974 ABC transporter related; PFAM:
FT                   ABC transporter related; TOBE domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87839"
FT                   /db_xref="GOA:D7A419"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A419"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87839.1"
FT                   /translation="MILELDGVSRTVAGVPYIRDVSLRLEHGSLNVLLGATLAGKTSLM
FT                   RLMAGLDAPTSGRILVDGRDVTGLPVKKRSVAMVYQQFINYPSLSVYENIASPLRVQGL
FT                   PKAEIETRVTEAAKLLKLEPYLQRLPLALSGGQQQRTAIARALVKRADLVLLDEPLANL
FT                   DYKLREELREELPRIFASTGAVFVYATTEPTEALLLGGNTATLMEGAVTQFGPTADVYR
FT                   RPADLATARVFSDPPLNMLKVTKSSGTVLLESGAVLPASGTFATAADGRYTMGVRAHHL
FT                   EVEDVAVAERTSHADGRIRLGAVISVTEVTGSESFLHMQMGEERLTALVPGVRRLEPNA
FT                   PVEVLIDPSHILLFDADGRRAGRVLDAAA"
     atgatcctcg aactcgacgg cgtcagccgg accgttgccg gcgtccccta tattcgcgac        60
     gtctcgctgc ggctggagca tggcagcctg aacgtgctgc tcggcgccac gctggccggc       120
     aagaccagcc tgatgcgcct gatggccggc ctcgacgcgc cgacctccgg ccgcatcctc       180
     gtcgacgggc gcgacgtcac cggactgccg gtgaagaagc gcagcgtcgc catggtctac       240
     cagcagttca tcaactaccc ttcgctgagc gtctacgaga acatcgcctc gccactgcgc       300
     gtgcaggggc tgccgaaggc cgagatcgag acgcgcgtca ccgaagccgc caagctgctg       360
     aagctggagc cttatctgca gcgcctgccg ctggcccttt ccggcggcca gcagcagcgc       420
     accgccattg cccgcgcgct ggtgaagcgc gccgacctcg tgctgctcga cgagccgctg       480
     gccaatctcg actacaagct gcgcgaggag ctgcgcgagg aattgccgcg catcttcgcc       540
     tccaccggcg cggtgttcgt ctatgcgacg accgagccga ccgaggcgct gctgctcggc       600
     ggtaatacgg cgacgcttat ggagggcgcg gtgacgcagt tcggcccgac cgccgatgtc       660
     tatcgccgcc ccgccgacct cgccaccgcg cgcgtcttct ccgatccgcc gctcaacatg       720
     ctgaaggtga cgaagtctag tgggaccgtg ctgctggaga gcggcgcggt gctgccggcc       780
     tccggcacct tcgccaccgc ggcggacggg cgctacacga tgggcgtgcg cgcgcatcac       840
     cttgaggtgg aggacgtcgc cgtcgccgag cgaacgagcc atgccgatgg gcgcatccgg       900
     ctcggcgcgg tcatctccgt caccgaggtc accggctcgg agagcttcct gcacatgcag       960
     atgggcgaag agcggctcac cgcgctggta ccgggtgtgc gccggttgga gccgaacgcg      1020
     ccggtcgagg tgctgatcga ccccagccac atcctgctgt tcgacgccga cggccgccgg      1080
     gccggtcgcg tgctcgacgc ggcggcatag                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page