(data stored in ACNUC1104 zone)

EMBL: CP002026.PE503

CP002026.PE503       Location/Qualifiers
FT   CDS_pept        529561..530658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0507"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: met:M446_1973 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87840"
FT                   /db_xref="GOA:D7A420"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D7A420"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87840.1"
FT                   /translation="MASITLDGLAHAYRPDPRGPQDYALKEINHVWRQGGAYALLGPSG
FT                   CGKTTLLNIISGLVTPTKGRILFDGRDVTNLPTEARNIAQVFQFPVVYDTMSVRENLAF
FT                   PLKNRHLPREAIARRVEEIAGRLDLTSVLDRKAANLTADAKQKISLGRGLVRSDVAAIL
FT                   FDEPLTVIDPHLKWQLRSTLKELHRALDLTMIYVTHDQTEALTFADTVVVMHDGAVVQT
FT                   GTPEELFERPAHTFVGHFIGSPGMNLLPASVEGRTAHIGGEHGVSVELARAYPALPAGE
FT                   RIELGVRPEFATLTRPGSGVPVKLRRIDDIGRARIARIEIAGHPAAATVPGALSLNGDE
FT                   AGLKLDPRQIHIYAGGVLVAGEGGA"
     atggccagca tcacgctcga cggtctcgcc catgcctacc ggcccgatcc gcgcggcccg        60
     caggactatg cgctgaagga gatcaaccat gtctggcggc agggcggcgc ctatgcgctg       120
     ctcggcccgt ccggctgcgg caagaccacg ctgctcaaca tcatctccgg cctcgtcacc       180
     ccgaccaagg gacgcatcct gttcgacggc cgcgacgtga ccaacctgcc gaccgaggcg       240
     cgcaacatcg cccaggtgtt ccagttcccg gtcgtctacg acacgatgag cgtgcgcgag       300
     aatctcgcct tcccgctgaa gaaccggcac ttgccgcgcg aggccatcgc acgtcgtgtc       360
     gaggagatcg ccgggcggct cgacctcacc tccgtgctcg accgcaaggc ggcgaacctc       420
     actgccgacg ccaagcagaa gatctcgctg gggcgcgggc tggtgcgctc ggacgtcgcc       480
     gccattctgt tcgatgagcc gctgaccgtc atcgacccgc atctgaaatg gcagctgcgc       540
     tcgacgctga aggagctgca ccgggcgctc gacctcacca tgatctatgt gacgcacgac       600
     cagaccgagg cgctgacctt cgccgacacg gtcgtcgtca tgcatgacgg cgcggtggtg       660
     cagaccggca cgccggagga gctattcgag cgccccgccc acaccttcgt cggccatttc       720
     atcggttcgc cgggcatgaa cctgctgccg gcttcggtcg aggggcgcac cgcccatatt       780
     ggcggcgagc acggcgtctc ggtggagttg gcgcgggcct atcccgcgct gccagcgggc       840
     gagaggatcg agctcggcgt gcggccggaa ttcgccaccc tcacgcgccc cggcagcggc       900
     gtgccggtga agctgcggcg catcgacgac atcggccgcg cccgcatcgc ccgcatcgag       960
     atcgccggcc acccggctgc ggcgaccgtg ccgggcgccc tatcgctcaa tggcgacgag      1020
     gccgggctaa agctcgatcc gcggcagatc catatctatg cgggcggcgt gttggtcgcc      1080
     ggcgagggag gggcgtga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page