(data stored in ACNUC1104 zone)

EMBL: CP002026.PE504

CP002026.PE504       Location/Qualifiers
FT   CDS_pept        530658..531560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0508"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rpt:Rpal_4892
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87841"
FT                   /db_xref="GOA:D7A421"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A421"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87841.1"
FT                   /translation="MDKPVNNRAWLLVAPVFLIVAFSAIVPIMTVVNYSVQDTFGNNQF
FT                   FWNGLGWFQELLDPSTELGGRFFDALWRNLLFSAIILAIEVPLGILVALSMPREGWKVA
FT                   ATLVVMALPLLIPWNVVGTIWQVFARADIGLLGYAVNWLGIPYNYTGDTLAAWITIIVM
FT                   DVWHWTSLVALLCYAGLKSIPDAYYQAARIDGASRWAVFTTIQLPKMKRVLLIAVLLRF
FT                   MDSFMIYTEPFVLTGGGPGNATTFLSIDLVKIALGQFDLGKAAAMSLVYNLIVLALCWV
FT                   FYTVMINAGTERRKQETPA"
     atggacaagc ccgtcaacaa ccgcgcctgg ctgctggtcg cgcccgtttt cctcatcgtc        60
     gccttctcgg ccatcgtgcc gatcatgacg gtggtgaact attcggttca ggacaccttc       120
     ggcaacaacc agttcttctg gaacggactc ggctggttcc aggaactgct cgacccctcg       180
     accgagctcg gcggccgttt cttcgacgcg ttgtggcgca acctcctgtt ctccgcgatc       240
     atcctcgcca tcgaagtgcc gctcggcatc ctcgtcgccc tgtccatgcc gcgcgagggc       300
     tggaaggtcg ccgccacgct ggtggtgatg gcgctgccgc tgctgatccc gtggaacgtc       360
     gtcggcacca tctggcaggt cttcgctcgc gccgatatcg gcctgctcgg ctatgccgtg       420
     aactggctcg gcatccccta caactacacg ggcgacacgc tggcggcgtg gatcaccatc       480
     atcgtcatgg acgtctggca ctggaccagc ctggtggcgc tgctgtgcta tgccggcctc       540
     aagtcgatcc cggatgccta ttaccaggcg gcgcgcatcg acggcgcctc gcgctgggcg       600
     gtgttcacca ccatccagct tccgaagatg aagcgcgtgc tgctgatcgc ggtgctgctg       660
     cgcttcatgg acagtttcat gatctacacc gagcccttcg tgctgaccgg cggcgggccg       720
     ggcaacgcca cgaccttcct ctccatcgac ctcgtgaaga tcgccctcgg ccagttcgac       780
     ctcggcaagg cggcggcgat gagcctcgtc tacaacctca tcgtgctggc gctgtgctgg       840
     gtgttctaca cggtgatgat caacgccggc accgagcgcc gcaagcagga gacgccggca       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page