(data stored in ACNUC1104 zone)

EMBL: CP002026.PE508

CP002026.PE508       Location/Qualifiers
FT   CDS_pept        complement(534601..535581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0512"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: dge:Dgeo_2171
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87845"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7A425"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADH87845.1"
FT                   /translation="MRSLGTDGLRVSDIGLGCYGMSGEYGTPNDPESIATIHRALELGL
FT                   DFIDTSDAYSAGKNEQLVGEALKGRRDKAILATKFGNVRGPNGERGFTNGRPDYVPVAC
FT                   EASLKRLGVEVIDLYYLHRIDPDVPIEETVGAMARLVEAGKVRHLGICEAGVNTIRRAH
FT                   ATHPLAALQTEYSLWSRDVEAEILPTVRELGIGFVAYSPLGRGFLTGAFRTRTDLIEAD
FT                   RRHDHPRFKEGNFEQNVGLLGTIERIAKKHGAALSQVALAWLLSRGDDIVPIPGTKRRS
FT                   YLEQNWGARAVTLDEDDIAALDAGFPLHAAAGGRYPKGQLDKLGL"
     atgcggtcac ttggcaccga cggactgcgc gtgtcggata tcgggctcgg ctgctacggc        60
     atgtccggcg aatacggcac gccgaacgat cccgaatcca tcgccacaat ccatcgcgcg       120
     ctggagctcg ggctcgactt catcgacacg tcggacgcct attccgccgg gaagaacgag       180
     cagctcgtcg gcgaggcgct gaaaggccgc cgcgacaagg cgatcctcgc caccaagttc       240
     ggcaatgtgc gcgggccgaa cggcgagcgc ggcttcacca atggccggcc ggactatgtc       300
     ccggtcgcct gcgaggccag cctgaagcgg ctcggggtgg aagtgatcga cctgtattat       360
     ctccaccgca tcgacccgga cgtaccgatc gaggagacgg tgggcgccat ggcgcggctg       420
     gtcgaggccg gcaaggtgcg ccatctcggc atatgcgagg cgggcgtgaa cacgatccgc       480
     cgggcgcatg cgactcatcc cctcgccgct ttgcagaccg aatattcgct gtggagccgc       540
     gacgtggagg cggagatcct gccgaccgtg cgcgagctcg gcatcggctt cgtcgcctat       600
     tccccactcg gccgcggctt ccttaccggc gccttccgca cccgcaccga cctcatcgag       660
     gccgaccgcc ggcacgacca tccacgcttc aaggaaggca atttcgagca gaatgtcggg       720
     cttctcggca ccatcgagcg cattgcgaaa aagcacggcg cggcgctgtc tcaggtggcg       780
     ctggcctggc tgctgtcgcg gggcgacgac atcgtgccga tccccggcac caaacgccgc       840
     agctacctcg aacagaactg gggcgcccgc gcggtgacgc tcgacgaaga cgatatcgcc       900
     gcgctcgatg ccggcttccc gctgcatgcg gcggcaggcg ggcgctatcc caaggggcag       960
     ctcgacaagc tcggccttta g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page