(data stored in ACNUC1104 zone)

EMBL: CP002026.PE51

CP002026.PE51        Location/Qualifiers
FT   CDS_pept        complement(41413..42216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0051"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: met:M446_2725 two-component response
FT                   regulator; PFAM: response regulator receiver; Sigma-70
FT                   region 4 type 2; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87388"
FT                   /db_xref="GOA:D6ZZX4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014605"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH87388.1"
FT                   /translation="MSTSQLVAQHLPFLRRYARALSGSQSAGDAYVTAMLETLIADPAI
FT                   LDRDADPRVALYRLLTRLWDSVSLNAKVDQTPAAIQGEHRLGHITPVVRQAFLLVSLEG
FT                   FTEEDAAQVLEIDVPTLRNLVEDAGRELAAEIATDVLIIEDEPFIALDLEGLVESLGHR
FT                   VTGIARTHTEAVELARRKAPGLILADIQLADGSSGLDAVNELIAKVEVPVIFITAYPER
FT                   FLTGVRPEPAFLIAKPFQPSTVAAVISQALFFERRARPREQRATA"
     gtgagcactt ctcaacttgt cgcgcagcac ctgccgttcc tgcgccgcta tgcgcgtgcg        60
     ctcagcggca gccagtccgc gggcgacgct tatgtaacgg cgatgctgga gaccctcatc       120
     gccgatcctg ccatcctcga ccgtgacgcc gatccccgcg ttgccctcta tcgcctcctc       180
     acccgccttt gggactcggt gtccctgaac gccaaggtcg accagacgcc ggcggcgatc       240
     cagggcgagc accgcctcgg ccacatcacc ccggtggtcc gccaggcctt cctgctggtc       300
     tcgctcgaag gcttcaccga ggaggacgcc gcgcaggtcc tcgagatcga tgtcccgacc       360
     ctgcgcaacc tcgtcgagga tgccgggcgc gagctggcgg cggaaatcgc caccgacgtc       420
     ctgatcatcg aggatgagcc cttcatcgcg ctggacctgg aaggcctcgt ggagagcctc       480
     ggccaccgcg tcaccggcat cgcccgcacc cataccgagg cggtcgagct cgcccgccgc       540
     aaggcgccgg gcctgatcct tgccgacatc cagctcgccg acggctcctc cggcctcgac       600
     gccgtgaacg agctgatcgc caaggtcgag gtgccggtga tcttcatcac cgcctatccg       660
     gaacgcttcc tcaccggcgt gcggccggag ccggccttcc tgatcgccaa gcccttccag       720
     ccctcgacgg tcgccgccgt catcagccag gcactgttct tcgagcgccg ggcgcgtcca       780
     cgggagcagc gcgcgaccgc ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page