(data stored in ACNUC1104 zone)

EMBL: CP002026.PE510

CP002026.PE510       Location/Qualifiers
FT   CDS_pept        536579..537316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0514"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bja:bll7370
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87847"
FT                   /db_xref="GOA:D7A427"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A427"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH87847.1"
FT                   /translation="MDSAFIEPTLDAGAAVGQLVLVPGLGCTEQLFAGQVCRLARHSRV
FT                   RFADTRRDDTIAGMARRLLEEVDGPFALAGLSMGGYVAMEVVRQAPSRVTRLALLDTTA
FT                   APDAESAREFRLKLSDLALRGHLDEVHEALWPRLVAPSRRDDAVLEGQVYSMLVATGGA
FT                   AFARQQNAIIGRADSRPVLEGVAVPTLIVVGSEDIVTPVATAAEMAGLVPGARLTVVEG
FT                   SGHLSTMEAAATVADAMEEWLTH"
     atggacagtg ccttcatcga gcccaccctc gacgccggcg ccgccgtcgg acagctagtg        60
     ctcgtgcccg gcctcggctg cacggagcag ctcttcgccg gccaggtctg ccggctcgcg       120
     cggcattcgc gggtgcgctt cgccgatacg cggcgcgatg acaccattgc cggcatggcc       180
     cgccggctgc tggaggaggt cgacggcccc ttcgcgctcg ccggactttc catgggcggc       240
     tatgtcgcca tggaggtcgt ccggcaggcg ccttcgcgtg tcacccggct ggctctgctc       300
     gacaccaccg cggcgcccga tgccgagagc gcccgcgagt tccgcctgaa gctcagcgat       360
     ctcgctctgc gcgggcacct cgacgaggtg catgaggcgc tgtggccgcg tctggtggcg       420
     ccgagccgcc gagatgacgc cgtcctcgaa gggcaggtct attcgatgct ggtcgccacc       480
     ggcggcgccg ccttcgcccg ccagcagaac gccatcatcg gccgcgccga ttcccgcccg       540
     gtgctggagg gcgtcgccgt gcccacgctg atcgtggtcg gctcggagga catcgtcacc       600
     ccggtcgcca ccgccgccga gatggccggt ctcgtgcccg gcgcaaggct gaccgtggtg       660
     gaaggctcgg gccatctcag cacgatggag gctgccgcca ccgtcgccga cgccatggag       720
     gagtggctga cgcactga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page