(data stored in ACNUC1104 zone)

EMBL: CP002026.PE511

CP002026.PE511       Location/Qualifiers
FT   CDS_pept        537402..539144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0515"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: avn:Avin_21310 ABC
FT                   transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87848"
FT                   /db_xref="GOA:D7A428"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A428"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87848.1"
FT                   /translation="MSSIAAASGVARPSAASRWLSLETFVLGGAILSLVILVVLPVASL
FT                   VVASLWSEDGVTLAYYERALTGGSYLRALGNSLTLGAWVGLISVIVGVPLAWAVSRTNV
FT                   PGKPLIQATATLSYLSPPFLTSIAFVNLFSPNAGIINVLLRDVLGLGITFDIFTMSGLV
FT                   FVTALHTFPFVYLLASSALQSVDASYEEAAQILGASKIRTALTITAPLVAPAILSGTLL
FT                   AFVNAIALFGSQAIIGLPGRIVTLPTRIYALFDYPPQYGLAAALSLLFVAITVIALYLQ
FT                   RMFLARRSYVTLGGKGARSQLVDLGPWRWVLFGVCVLVCLFAVVMPFASLIAVSLSKSW
FT                   GLDFWQSLTLDNYRFILFEYDVTRRAILNSLVLATIAATACVALGAIIGWIDVRTKMPG
FT                   RRLLDYASLVPLGLPGIVMAVALLQFWLSVPYIVLYGTFAILLLAYIGRYVPLGVRAAN
FT                   SSLRQVDPSLEEAAHILGASWGHTMREITLPLIRPGLLAGWLLVFVPVVQELSASILLF
FT                   SSGTITLAVAVYNLYETGYIEPVSALAMVNMTIIVVAMLIAHRLGAGRKTVSDDSSTSF
FT                   GGAR"
     atgagttcga tcgccgctgc gagcggcgtg gcgcgcccga gtgcagcatc gcgctggtta        60
     agcctcgaga cctttgtgct gggaggcgcg atcctctcgc tcgtcatcct cgtcgtcctg       120
     cccgtcgcct cgctggtggt cgccagcctg tggtctgagg acggcgtcac cctggcctat       180
     tacgagcggg cgctgaccgg cggctcctat ctgagggcgc tgggcaattc gctcacgctg       240
     ggcgcctggg tcgggctgat cagcgtcatc gtcggcgtgc cgctcgcctg ggcggtgagc       300
     cgcaccaatg tgccgggcaa gccgctgatc caggcgacgg cgacgctctc ttatctgtcg       360
     ccgcccttcc tcacctccat cgccttcgtg aatctattca gccccaatgc cgggatcatc       420
     aacgtcctgc tgcgcgacgt gctggggctg gggatcacct tcgacatctt caccatgagc       480
     ggcctcgtct tcgtcacggc gctgcacacc ttccctttcg tgtacctctt ggcatcaagc       540
     gcgctgcagt cggtcgatgc gtcttatgag gaggcggcgc agatcctcgg cgccagcaag       600
     atccgcacgg cactcaccat caccgcgcca ttggtggcgc ccgccatcct gtccggcacg       660
     ctgctcgcct tcgtgaacgc catcgcgctg ttcggctcac aggcgatcat cggcctgccc       720
     ggtcgcatcg tgacgctgcc gacgcgcatc tacgcgctgt tcgactatcc cccgcaatac       780
     gggctggcgg cggcgctgtc gctgctcttc gtcgccatca ccgtcatcgc gctctatctc       840
     cagcgcatgt tcctggcgcg gcgctcctat gtgacgctcg gcggcaaggg agcgcgcagc       900
     caattggtcg atctcggccc ctggcgctgg gtgctgttcg gcgtctgcgt gctggtgtgc       960
     ctgttcgccg tggtcatgcc cttcgcctcg ctcatcgccg tgtcgctgag caagtcgtgg      1020
     gggctggatt tctggcagag cctgacgctc gacaattaca ggttcatcct gttcgagtac      1080
     gacgtcaccc gccgcgccat cctcaacagc ctcgtcctgg cgaccatcgc cgccaccgcc      1140
     tgcgtggccc tcggcgccat catcggctgg atcgacgtgc gcacgaagat gccggggcgg      1200
     cgcctgctcg actacgcctc gctggtgccg ctcggcctgc cgggcatcgt catggcggtg      1260
     gcgctgctgc agttctggct gtcggtgcct tacatcgtgc tctacggcac cttcgccatc      1320
     ctgctgctgg cctatatcgg ccgctacgtg ccgctcggcg tgcgtgcggc gaactcctcg      1380
     ctgcgccagg tcgacccttc gctggaggag gcggcgcaca tactcggcgc ctcctggggc      1440
     cacaccatgc gcgagatcac cctgccgctg atccggccgg gcctgctcgc cggctggctg      1500
     ctggtgttcg tgccggtggt gcaggagctc tcggcgtcga tcctgctgtt ctcgtccggc      1560
     accatcaccc tcgcagtggc ggtctacaac ctctacgaga ccggctacat cgagccggtc      1620
     tccgccctcg ccatggtcaa catgaccatc atcgtcgtcg ccatgctgat cgcgcaccgc      1680
     ctcggtgccg gccgcaagac ggtgagcgac gacagcagca cgtcgttcgg aggcgcacgc      1740
     taa                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page