(data stored in ACNUC1104 zone)

EMBL: CP002026.PE512

CP002026.PE512       Location/Qualifiers
FT   CDS_pept        539144..540232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0516"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tga:TGAM_1014 ABC-type transport system,
FT                   ATPase component, putative Fe3+ transporter (FbpC/AfuC);
FT                   PFAM: ABC transporter related; Transport-associated OB
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87849"
FT                   /db_xref="GOA:D7A429"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A429"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87849.1"
FT                   /translation="MARILISGLTKSYTGNGAALSALDLDIKDNQFVTLLGPSGCGKTT
FT                   TLRLIAGYMTPDAGTIRVGDRVISSAEGVAPPDKRGMGMVFQNYAVWPHKTVYENVVFG
FT                   LKLRRIPSEEARRRVLETLALVNLTGLENRFPAELSGGQQQRVALARSLVVEPEILLLD
FT                   EPLSNLDAKLRERMRLELKQLQRRTGITFVYVTHDQAEALALSDQIAVMHGGKLQQYGT
FT                   PDDVYRRPANKIVADFMGIVNFVPGIARGGETIEIDGVEMRSPHAGGLVPGEPIDVAVR
FT                   PENVRLSRDGADGKRLTGTITEKTYLGNLIEYWVQLASGAVLRAQTHPLEQFDPGEAVG
FT                   LVIDAQESSVFPRGEASPSTKH"
     atggccagga tcctcatctc cgggctgacc aagtcctata ccggcaacgg cgccgcgctg        60
     agcgcgctcg acctcgacat caaggacaac cagttcgtca ccctgctcgg cccgtccggc       120
     tgcggcaaga cgacgacgct gcgcctgatc gccggctaca tgacaccgga tgccggcacc       180
     atccgggtcg gcgaccgggt catctcgtcg gccgaaggcg tcgccccgcc ggacaagcgc       240
     ggcatgggca tggtgttcca gaactatgcc gtctggccgc acaagacggt ctacgagaac       300
     gtcgtcttcg gcctgaagct gcgccggatc ccttcggagg aggctcggcg ccgcgtgctg       360
     gagacgctag cgctggtgaa cctcacgggt ctcgagaacc gcttcccggc cgagctctcc       420
     ggcgggcagc agcagcgcgt ggcgcttgcc cgcagcctgg tcgtggagcc ggagatcctg       480
     ctgctcgacg agccgctgtc caatctcgac gccaagctgc gcgagcgcat gcggctcgaa       540
     ctgaagcagc tccagcggcg taccggcatc accttcgtct atgtgacgca cgaccaggcc       600
     gaggcgctgg cgctctccga ccagatcgcg gtcatgcatg gtggcaagct ccagcaatac       660
     ggcacgcctg acgatgtcta ccggcgcccg gccaacaaga tcgtcgccga cttcatgggc       720
     atcgtgaact ttgtgccggg catcgcgcgc ggcggcgaga cgatcgagat cgacggcgtc       780
     gagatgcgct cgccgcatgc gggcgggctc gtccccggcg agccgatcga cgtcgcggtg       840
     cggccggaga atgtgcgcct gtcccgcgac ggagcggacg gcaagcggct caccgggacg       900
     atcaccgaga agacctatct cggcaacctc atcgaatact gggtgcaact cgcctccggc       960
     gcggtgctgc gggcgcagac gcatccgctg gagcagttcg atccgggcga ggccgtgggc      1020
     ctcgtcatcg atgctcagga gagcagcgtc ttcccgcgcg gcgaggcgtc accctcgacc      1080
     aaacactag                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page