(data stored in ACNUC1104 zone)

EMBL: CP002026.PE513

CP002026.PE513       Location/Qualifiers
FT   CDS_pept        540259..541185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0517"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mms:mma_0818
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87850"
FT                   /db_xref="GOA:D7A430"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A430"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH87850.1"
FT                   /translation="MQSATAPKPVVTGREHWTKNGDAELFLWQKAPADGRTPAGTILFV
FT                   HGSSMASQPTFDLQVPGRPWSSAMDYFVDKGFETWCVDMRGYGRSDKRPGTRATIAEGA
FT                   EDLVAATDYIIRETGATSFHTYGISSGALRAAAFTELKPERVKRLALDAFVWTGEGSHT
FT                   LENRRKKLPDFREGERRPIDKAFVYSIFNRDHPGAAEDKVIEAFADGITALDDSMPNGT
FT                   YIDMCTRLPLIDPAKITVPTIIMRGEWDGIAGFDDLAAFFKLLPNPDKQFAVMPGISHA
FT                   SIQQKNYMIVYHILHAFFTQPDPVYRG"
     atgcagagcg cgaccgcgcc gaagcccgtc gtcaccgggc gcgagcactg gacgaagaac        60
     ggcgatgccg agctgttcct ctggcagaag gcgcccgccg acgggcgcac gccggccggc       120
     accatcctgt tcgtccacgg ctcgtccatg gcctcgcagc cgaccttcga cctgcaggtg       180
     cccggccggc cgtggtcctc ggcgatggac tatttcgtcg acaagggctt cgagacctgg       240
     tgcgtcgaca tgcgcggcta tggccgctcc gacaagcggc cgggcacgcg cgcgaccatc       300
     gccgagggcg ccgaggatct ggtggcggcg accgactaca tcatccgcga gaccggggcg       360
     acgtcgttcc acacctacgg catctcctcc ggcgcgctgc gcgccgccgc cttcaccgag       420
     ctcaagcccg aacgcgtgaa gcgcctcgcg ctcgacgcct tcgtgtggac cggggagggc       480
     agccacacgc tggagaaccg gcgcaagaag ctccccgact tccgcgaggg cgagcggcgg       540
     ccgatcgaca aggccttcgt ctattcgatc ttcaaccgcg accatcccgg cgcggctgag       600
     gacaaggtga tcgaagcctt cgccgacggc atcaccgccc tcgacgattc catgccgaac       660
     ggcacctata tcgacatgtg cacgcggctg ccgctcatcg acccggcgaa gatcaccgtg       720
     ccgaccatca tcatgcgcgg cgagtgggac ggcatcgccg gcttcgacga tctcgccgcc       780
     ttcttcaagc ttctgcccaa tcccgacaag cagttcgcgg tgatgccggg catctcgcac       840
     gcctcgatcc agcagaagaa ctacatgatc gtctaccaca tactgcacgc cttcttcacc       900
     cagccggacc ccgtctatcg cggctga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page