(data stored in ACNUC1104 zone)

EMBL: CP002026.PE514

CP002026.PE514       Location/Qualifiers
FT   CDS_pept        541225..542262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0518"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tga:TGAM_1016 ABC-type Fe3+ transport system,
FT                   periplasmic component (FbpA/AfuA)"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87851"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:D7A431"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH87851.1"
FT                   /translation="MLKNAIVHRSVRCWLAAGAGLLIGSFAFAASAEEVDMAKAKAEGK
FT                   LVWYTSTAIGQANNLALMFEKQTGIKVELFRSGGSAILRRFMQEASAGKIAADVMTMSD
FT                   PAAADQLSEKGTFVAFKPKDFDKITETARNKDGYWIAQRLNAITIYMRGDKVPPAERPK
FT                   KWTDLTDAKYDGKLVMTDPSFTSVQLTTVGVLADKYGWDYYEKLNDGDIMIVQGNQQVA
FT                   DNIKRGERLIAVGALDVYIAADRRNGHDFVSIYPEDGTLLIPSPTGIIKGGPHPNAAKA
FT                   FAEFMISPEAQKTFPETGEYSARVDMAPPAGNPKVDEIKLMPVDYEKLETQAAEIKEKF
FT                   NDIFR"
     atgctgaaga acgccatcgt gcatagatcc gtgcgttgct ggcttgccgc cggcgcgggc        60
     ctcctcatcg gcagcttcgc cttcgccgcc tcggcggagg aggtcgacat ggccaaggcg       120
     aaggccgagg gcaagctggt ctggtacacc tcgaccgcca tcgggcaggc caacaacctc       180
     gcgctgatgt tcgagaagca gaccggcatc aaggtcgagc tgttccgctc gggcggctcg       240
     gccatcctgc gccgcttcat gcaggaagcc tccgccggca agatcgcggc cgacgtgatg       300
     acgatgtcgg acccggccgc ggccgaccag ctctccgaga agggcacctt cgtcgccttc       360
     aagccgaagg acttcgacaa gatcaccgaa accgcgagga acaaggacgg ctactggatc       420
     gcccagcgcc tcaacgccat caccatctac atgcgcggcg acaaggtgcc gccggccgag       480
     cggcccaaga agtggaccga cctcaccgac gcgaaatatg acggcaagct ggtgatgacc       540
     gacccgagct tcacctcggt ccagctcacc acggtcggcg tgctcgccga caagtatggc       600
     tgggactact acgagaagct gaacgacggc gacatcatga tcgtccaggg caaccagcag       660
     gtcgccgaca acatcaagcg cggcgagcgg ctcatcgcgg tgggcgcgct cgacgtctac       720
     atcgccgccg accgccgcaa cggccacgac ttcgtctcga tctatccgga ggacggcacg       780
     ctgctgatcc cctcgccgac ggggatcatc aagggcggcc cgcacccgaa cgcggccaag       840
     gccttcgccg agttcatgat cagccccgag gcgcagaaga ccttcccgga gaccggcgaa       900
     tattcggcgc gcgtcgacat ggcgccgccc gccggcaatc ccaaggtcga cgagatcaag       960
     ctgatgccgg tggactatga gaagctggaa acccaggccg ccgagatcaa ggaaaagttc      1020
     aacgacatct tccgctga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page