(data stored in ACNUC1104 zone)

EMBL: CP002026.PE519

CP002026.PE519       Location/Qualifiers
FT   CDS_pept        547189..547965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0523"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: bja:blr2694 VirG-like two component response
FT                   regulator; PFAM: transcriptional regulator domain protein;
FT                   response regulator receiver; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87856"
FT                   /db_xref="GOA:D7A436"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7A436"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADH87856.1"
FT                   /translation="MHQLVSVSRHEVPANPLDRPFPLGRVLVVDDDRDMRHAVIGHLNE
FT                   HRCHAVGCGVRDMPHHLRHDQFSLIVLDVQSGPPDRFAVLRQIRDRSPVPVILVACQRC
FT                   NDADRIVALELGADDCLIKPFDPRELLARAGAILRRQEMGRQLTARPVRGGYRFNGWEL
FT                   RRRTRRLTDPSGKAVDLTKGGYALLVAFLEAPLRPLSREQLLSATRTHQDVFDRSIDVQ
FT                   VLRLRRKLEPDPAQPRLIRTERGIGYVFDAAVETVF"
     atgcatcaac tcgtgagtgt cagccggcac gaagtcccgg caaatccgct cgatcgtcct        60
     ttccctctcg gacgcgtgct ggtggtcgac gacgaccgcg acatgcgcca cgccgtcatc       120
     ggtcatctga acgagcaccg atgccacgcc gtcggctgcg gcgtccgcga catgccgcat       180
     catctgcggc acgaccagtt cagcctcatt gtgctggacg tccagtccgg cccgcccgac       240
     cgtttcgcgg tgctgcgcca gatccgcgac cgttcgcccg tgccggtgat ccttgtcgcc       300
     tgccagcgct gcaacgacgc cgaccgcatt gtcgcccttg agctcggcgc cgatgattgc       360
     ctcatcaagc ctttcgaccc gcgcgaattg ctggcgcggg ccggggccat cctgcgccgg       420
     caggaaatgg gccggcagct caccgccagg ccggtgcggg gcggctaccg cttcaacggt       480
     tgggagctga ggcgccgcac gaggcggctg accgatccct ccggcaaggc cgtcgatctc       540
     accaagggcg gctatgcgct gctggtggcg ttcctcgagg cgccgctgcg gccgctgtcg       600
     cgcgagcaac tgctgagcgc tacgcgcacg catcaggacg tgttcgaccg cagcatcgac       660
     gtccaggtgc tgcggctgcg gcgcaagctg gagccggacc cggcccagcc gcggcttatc       720
     cggaccgagc gcggcatcgg ctatgtcttc gatgccgccg tggagaccgt gttctga          777
//

If you have problems or comments...

PBIL Back to PBIL home page