(data stored in ACNUC1104 zone)

EMBL: CP002026.PE520

CP002026.PE520       Location/Qualifiers
FT   CDS_pept        complement(547980..548891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0524"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: scl:sce1410 putative AraC-like transcription
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; protein of unknown function DUF861
FT                   cupin_3; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87857"
FT                   /db_xref="GOA:D7A437"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:D7A437"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADH87857.1"
FT                   /translation="MTDPLSQIVQLLRPRAVYSKAMSGAGRWGVRYSDFGQPGFCAVIE
FT                   GRCLLTLDGKAPVALEEGDFVLLPATPAFTMSGFEPVALAPLDPRATPTPTGEVRHGRA
FT                   EGPPDVRLFGGHFTFESPDAALLVALLPAMIHVRGIPRLSQLVRVLGEEAGEDAIGRDL
FT                   VLARLVEILLIEALRAAPREDASPSLLRGLADPRIALALRQMHGEAERAWTVAELARGT
FT                   GMSRSAFFDRFARTVGICPMEYLLAWRMALAKDLLRGGHIALDEVARRIGYGSASTFST
FT                   AFSRHVGQPPGRFMREAARTAA"
     atgacagacc ctctgtccca gatcgtccag ctcctgcggc cgcgcgccgt ctactccaag        60
     gcgatgagcg gcgcggggcg ctggggcgtg cgctattccg acttcggaca gcccggcttc       120
     tgcgcggtga tcgaggggcg ttgccttctc accctcgacg gcaaggcacc ggtcgcgttg       180
     gaagaaggcg acttcgtgct gctgccggcg acacccgcct tcaccatgtc cggcttcgag       240
     ccggtggcgc tggcgccgct cgacccgagg gcgaccccga cgccgaccgg ggaagtgcgg       300
     cacgggcgcg ccgaggggcc gccggacgtc cggctgttcg gcgggcactt caccttcgaa       360
     tcgccggacg ccgccctcct cgtggcgctg ctgccggcga tgatccatgt ccgcggcatc       420
     ccgcggctgt cccagctggt gcgtgtcctc ggcgaggagg ccggcgagga cgccatcggc       480
     cgcgacctcg tgctcgcgcg cctcgtcgag atcttgctga tcgaggcgct gcgggctgcg       540
     ccccgcgagg acgcctcgcc gagcctgctg cgcgggctgg cggacccacg catcgcgctg       600
     gcgctcaggc agatgcacgg cgaggccgag cgggcctgga cggtcgccga gctggcgcgc       660
     gggaccggca tgtcgcggtc ggccttcttc gaccgcttcg cccgcaccgt cggcatatgc       720
     ccgatggagt atctgctggc ctggcgtatg gccctcgcca aggacctctt gcgcggcggg       780
     catatcgcgc tggacgaagt agcacggcgc atcggctacg ggtcggccag caccttcagc       840
     accgccttca gccggcatgt cggccagccg ccgggccggt tcatgcgcga ggcggcacgg       900
     acggcggcct ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page