(data stored in ACNUC1104 zone)

EMBL: CP002026.PE522

CP002026.PE522       Location/Qualifiers
FT   CDS_pept        complement(549738..550619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0526"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: bpt:Bpet4157 LuxR family transcriptional
FT                   regulator; PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87859"
FT                   /db_xref="GOA:D7A439"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A439"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADH87859.1"
FT                   /translation="MQAAERAITPEGTSHDAGLAQEIIGLYEAEPDLITLPAALFAGVG
FT                   RLIDADVVTYSEFHHTSGEFRSLLSVEDDPARRAEGIAAYARHMHSHAFWRYDPAFFGE
FT                   RALRESDFFSDEEFLALPIAREVFLPSNARHIMSIVMRHEAYVLTINGFRTIGRTAFSD
FT                   AARDRLEAFRPHIMRSYRQAFQRTLATLTPTDRLRIAFPELTPRQLEVGSWIARGKSNE
FT                   DIATILDVGVDTVKAHVKAIHAKVGADGRLAIAVIAHTIPPFARMPPLWRIGEDVWAGA
FT                   AQRERDRPRRAS"
     atgcaggcgg cggaacgcgc cattacccca gagggtacat cccacgacgc cgggctggcg        60
     caggagatca taggtctcta cgaggccgag cccgacctca tcaccctgcc cgcggctttg       120
     ttcgccggcg ttggacgtct tatcgacgcc gacgtcgtga cctattccga gttccatcac       180
     accagcggcg agttccgctc gctgctgtcg gtggaggacg acccggcgcg gcgggcggaa       240
     ggcatcgccg cctatgcccg ccacatgcac agccacgcct tctggcgcta cgaccccgcc       300
     ttcttcggcg agcgggcgct gcgcgaatcc gacttcttca gcgacgagga attcctcgcc       360
     ttgccgatcg cgcgggaggt gttcctgccg tccaacgccc ggcacatcat gtccatcgtc       420
     atgcggcacg aggcctatgt gctgaccatc aacggcttcc ggacgatcgg gcggacggcc       480
     ttcagcgacg ccgcgcgcga ccggctggag gccttccgcc cgcacatcat gcgcagctac       540
     cggcaggcct tccagcgcac cctcgccacg ctgacgccaa ccgaccggct gcgcatcgcc       600
     ttccccgagc tgacaccgcg ccagctcgaa gtcggctcct ggatcgcccg cggcaagtcg       660
     aacgaggaca tcgccaccat cctcgacgtc ggcgtcgaca cggtgaaggc gcacgtcaag       720
     gcgatccacg ccaaggtcgg cgccgacggg cgcctcgcca tcgcggtcat cgcccacacc       780
     atcccgccct tcgcgcgcat gccgccgctg tggcggatcg gcgaggacgt atgggcgggc       840
     gccgcccagc gcgagcgcga ccggccgcgg cgggcgtcct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page